SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000050654 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000050654
Domain Number 1 Region: 7-44
Classification Level Classification E-value
Superfamily SAP domain 0.0000000044
Family SAP domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000050654   Gene: ENSBTAG00000032446   Transcript: ENSBTAT00000046016
Sequence length 168
Comment pep:known chromosome:UMD3.1:3:18288308:18288811:1 gene:ENSBTAG00000032446 transcript:ENSBTAT00000046016 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATETVELHKLKLAELKQECLARGLETKGIKQDLINRLQAYLEEHAEEEANEEDVLGDET
EEEEPKPLELPVKEEEPPEKTVDVAAEKKVVKITSEIPQTERMQKRAERFNVPVSLESKK
AARAARFGISPVPSKGLSSDTKPMVNLDKLKERAQRFGLNVSSISRKS
Download sequence
Identical sequences E1BEF1
ENSBTAP00000050654 9913.ENSBTAP00000050654 ENSBTAP00000050654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]