SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000050801 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000050801
Domain Number 1 Region: 82-212
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 6.54e-45
Family Regulator of G-protein signaling, RGS 0.00000026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000050801   Gene: ENSBTAG00000021837   Transcript: ENSBTAT00000054910
Sequence length 223
Comment pep:known chromosome:UMD3.1:13:54270412:54275998:1 gene:ENSBTAG00000021837 transcript:ENSBTAT00000054910 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPTPPEAEKQQTGPEEADQPPSMSSHDAAPPAPPRRNPCCLCWCCCCSCSWNEERRRAWR
ASRESRLQPLPSCEVCATPTPTPTPTPEEVRSWAQSFDKLMHSPAGRSVFREFLRTEYSE
ENMLFWLACEELKAEANQHVVDEKARLIYEDYVSILSPKEVSLDSRVREGINKKMQEPSA
HTFDDAQLQIYTLMHRDSYPRFLSSPAYRALLLQGASQSSSEA
Download sequence
Identical sequences Q08DC7
ENSBTAP00000050801 NP_001070383.1.59421 NP_001070383.1.76553 ENSBTAP00000050801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]