SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000051020 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000051020
Domain Number 1 Region: 247-516
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.77e-80
Family Protein kinases, catalytic subunit 0.000000000178
Further Details:      
 
Domain Number 2 Region: 137-279
Classification Level Classification E-value
Superfamily SH2 domain 1.12e-38
Family SH2 domain 0.00000275
Further Details:      
 
Domain Number 3 Region: 79-161
Classification Level Classification E-value
Superfamily SH3-domain 2.14e-22
Family SH3-domain 0.0000396
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000051020   Gene: ENSBTAG00000007932   Transcript: ENSBTAT00000056914
Sequence length 524
Comment pep:known_by_projection chromosome:UMD3.1:13:62106257:62151619:1 gene:ENSBTAG00000007932 transcript:ENSBTAT00000056914 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGGRSSCEDPGCPPEEERAPRMGCVKSKFLRNGGKVSKTEPNTNPHSPLYVPDPTSSGKR
WPDSSNGNPPGSTEGSEDIIVVALYDYDAIHHEDLSFQKGDQMVVLEESGEWWRARSLAT
RKEGYIPSNYVARVNSLETEEWFFKGISRKDAERQLLAPGNVLGSFMIRDSETTKGSYSL
SVRDYDPQHRDTVKHYKIRTLDNGGFYISPRSTFGSLQELVAHYKKASDGLCQKLTVPCM
SSKPQKPWEKDAWEIPRESLKMEKKLGAGQFGEVWMATYNKHTKVAVKTMKPGSMSVEAF
LAEANLMKTLQHDKLVKLHAVVTEEPIYIITEFMAKGSLLDFLKSEEGSRQPLPKLIDFS
AQIAEGMAFIERRNYIHRDLRAANILVSASLVCKIADFGLARVIEDNEYTAREGAKFPIK
WTAPEAINFGSFTIKSDVWSFGILLMEIVTYGRIPYPGMSNPEVIRALERGYRMPRPDNC
PEELYNIMTRCWKNRPEERPTFEYIQSVLDDFYTATESQYQQQP
Download sequence
Identical sequences F1MWN2
ENSBTAP00000037156 ENSBTAP00000051020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]