SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000051656 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000051656
Domain Number 1 Region: 32-127
Classification Level Classification E-value
Superfamily SH2 domain 1.88e-27
Family SH2 domain 0.00000604
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000051656   Gene: ENSBTAG00000038154   Transcript: ENSBTAT00000052140
Sequence length 329
Comment pep:known_by_projection chromosome:UMD3.1:7:7886059:7894496:-1 gene:ENSBTAG00000038154 transcript:ENSBTAT00000052140 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEARRLPPPLPPRLDWFVQTQVDQLTCEGVPEWFHGAISREDAENLLESQPLGSFLIRV
SHSHVGYTLSYKAQNCCHHFMVKLLDDGSFTIPGEERVHDSLDALVTFYQQQPLRPHGDL
LMQSCPQRDPVNVDYEDLFLYSNALVEEDSRKVASPIWKASAKPGPLHRSKERKLSAGLK
GASMEGPLEEARQKLWRNLRMLPKTGRKVQKQLKSHLATLSSSSVTNGSETGTGDTAWEN
NVDKDPFVATSLASPAQPQAPRNRQGPSRKTSRSVSWNEAASKVKDWHQTVVRVLSLQAS
KPGPVDLREPQDSLPEEYRPPPPFAPGYC
Download sequence
Identical sequences E1B9W0
ENSBTAP00000051656 9913.ENSBTAP00000051656 ENSBTAP00000021412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]