SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000051686 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000051686
Domain Number 1 Region: 330-443
Classification Level Classification E-value
Superfamily SH2 domain 9.15e-22
Family SH2 domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000051686   Gene: ENSBTAG00000021358   Transcript: ENSBTAT00000056369
Sequence length 459
Comment pep:known_by_projection chromosome:UMD3.1:26:17380665:17466937:-1 gene:ENSBTAG00000021358 transcript:ENSBTAT00000056369 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKLNKITVPASQKLRQLQKMVHDIKNNEGGIMNKIKKLKVKAPPSVPRRDYAPESPADE
EEQWSDDFDSDYENPDEHSDSEMYVLPAEEAGDDSYEPPPVEQETRTVHPALPFTRGEYV
DNRSSQRQSPPFSKTLPSKPNWPSAKARLATSLPANTSLHKPQVPPKPKELLEDEADYVV
PVEDEDENYIHPTEDSSVPSEKAPMVNRSIKPNNSSKSASPPGTAPGRKSGAWDSKSTSL
PAAPSPLPRAGKKTAMPLKTTPVASQQNASSVCEEKPIPAERHRGSSHRQENMQSPVFPP
PAQKAVHQKPIPLPRFPEGGSPTVDGPLPSFSSNSSLSEQEADVHCKPWYAGACDRKSAE
EALYRSNKDGSFLIRKSSGHDSKQPYTLVVFFNKRVYNIPVRFIEATKQYALGRKKTGEE
YFGSVAEMIKNHQHNPLVLIDSQNNTKDSTRLKYAVKVS
Download sequence
Identical sequences F1MDI4
ENSBTAP00000051686 ENSBTAP00000051686 9913.ENSBTAP00000051686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]