SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000051737 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000051737
Domain Number 1 Region: 9-242
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 9.42e-63
Family Eukaryotic proteases 0.000000596
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000051737   Gene: ENSBTAG00000038159   Transcript: ENSBTAT00000056052
Sequence length 244
Comment pep:known chromosome:UMD3.1:21:35145469:35152721:1 gene:ENSBTAG00000038159 transcript:ENSBTAT00000056052 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLFLLLVALLSPTGEAGKIIGGHEAKPHSRPYMVFLQFKISGEPQRCGGFLVREDFVLT
AAHCLGSSINVTLGAHNIMDRERTQQFIPVRRPIPYPRYNKTWANDIMLLQLERKAKQMS
AVKPLSLPKAKAQMKPGQVCSLAGWGQVALGTPATTLQEAELMVQEDRMCESLNPRHYSR
ATQNCVGDPRKVKTGFKGDSGGPLVCKKVVHGTFSYGKKNGTPLGVFIQVSHFLPWIKRT
MKHL
Download sequence
Identical sequences F1MJG9
ENSBTAP00000051737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]