SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000051782 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000051782
Domain Number 1 Region: 60-133
Classification Level Classification E-value
Superfamily Ribosomal protein S18 2.88e-22
Family Ribosomal protein S18 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000051782   Gene: ENSBTAG00000025571   Transcript: ENSBTAT00000056429
Sequence length 196
Comment pep:known_by_projection chromosome:UMD3.1:23:17151843:17168154:-1 gene:ENSBTAG00000025571 transcript:ENSBTAT00000056429 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALNVLVSGCGRFLRGLLTGPTVTSWARPPARGFREVVEIQEGKTTIIEGRITGTPKES
PNPPNPSGQCPICRWNLKHKYSYEDVLLLSQFIRPHGGMLPRSITGLCQEEHRKIEECVK
MAHRAGLLPNHRPKLPEGFVPKTRPRLNRYLTRWSPRSVKPIYNKGHRWNKVRMAVGSPL
LKDNVSYTGRPLVLYH
Download sequence
Identical sequences F1MJC2
XP_010861416.1.44457 ENSBTAP00000051782 ENSBTAP00000051782 9913.ENSBTAP00000051782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]