SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000051933 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000051933
Domain Number 1 Region: 5-267
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.21e-73
Family Eukaryotic proteases 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000051933   Gene: ENSBTAG00000038616   Transcript: ENSBTAT00000053200
Sequence length 300
Comment pep:known_by_projection chromosome:UMD3.1:22:53315513:53337107:1 gene:ENSBTAG00000038616 transcript:ENSBTAT00000053200 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CRPALCCPQASVASVTGSWFRACGQTNISCKNVNGKLVEVGKWPWQVSILFLGMSICSGS
LIHRQWVLTAAHCLQRSKDPLSYSVKMGVQSLLENGTERQVARITIHEDFTNLSQDLALL
KLRDSVSWSPLIQPVCLPNPKLKPSFGSLCWMIGWGKVDIHANPQSPYSLQEVAVKIINN
DICNQQYKFLFLTNQKKLLGNDMICATSHLGMDTCQSNSGNSLVCQMDNSWIQMGVVTWS
FSCNRRHFPAVYTSTSYFTNWMRKQIGDVKFVSRAGPACLSPVLLTSSILLISSGCLWLL
Download sequence
Identical sequences F1MB31
ENSBTAP00000051933 ENSBTAP00000051933 9913.ENSBTAP00000051933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]