SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000052086 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000052086
Domain Number 1 Region: 23-259
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.95e-64
Family Eukaryotic proteases 0.000000143
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000052086   Gene: ENSBTAG00000037578   Transcript: ENSBTAT00000052512
Sequence length 260
Comment pep:known chromosome:UMD3.1:21:35122225:35125000:1 gene:ENSBTAG00000037578 transcript:ENSBTAT00000052512 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TEAARALGSLSEKMHHPPLPLLLLLLLCCRTQAGEIIEGTESKPHSRPYMAYLQIVTWDG
KQKACGGFLIRRDFVLMAAHCAGRSVTVTLGAHNLQKKEDTWQRLEVIKQFPYPKYEHVG
LHDIMLLKLKEKANLTLAVGTIPLPSHFTFIHPGIMCRVAGWGQTAVNEPASSTLQEVKL
RLMEPRACSHFSAFNHNLQLCVGNPQSTKSAFKGDSGGPLLCAGVAQGIVSYGLPSAKPP
AVFTRISPYRPWIDEVLKEN
Download sequence
Identical sequences E1B8U1
ENSBTAP00000052086 ENSBTAP00000052086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]