SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000052108 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000052108
Domain Number 1 Region: 6-243
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.57e-70
Family Eukaryotic proteases 0.00000146
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000052108   Gene: ENSBTAG00000040134   Transcript: ENSBTAT00000054741
Sequence length 251
Comment pep:known chromosome:UMD3.1:21:35184046:35187216:-1 gene:ENSBTAG00000040134 transcript:ENSBTAT00000054741 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWPLLLLVAFLLSPRARAGQIIGGREARPHSHPYMAYIQTLTPAGPTICGGFLVREDFVM
TAARCLGSQINVILGIHSVTASEWTQQRIPVLRPIPHPRYNQRNNQNDIMLLQLANRARQ
NEAVRLVALPQTEEMLSPGTQCTVAGWGLTRLHRRAITLQEVQLTIQRDGECHSRFDFYT
GQKQICVGDPREGKSTFLGDSGGPLVCSNVAQGIVSYGDRMGTPPAVFTRISSFLPWIRR
TMRRFQEWRPE
Download sequence
Identical sequences E1BAD2
ENSBTAP00000052108 ENSBTAP00000052108 9913.ENSBTAP00000052108 XP_015314760.1.76553 XP_015324017.1.59421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]