SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000052219 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000052219
Domain Number 1 Region: 18-182
Classification Level Classification E-value
Superfamily EF-hand 7.4e-47
Family Penta-EF-hand proteins 0.0000000723
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000052219   Gene: ENSBTAG00000010390   Transcript: ENSBTAT00000053811
Sequence length 183
Comment pep:known chromosome:UMD3.1:4:72774525:72796824:-1 gene:ENSBTAG00000010390 transcript:ENSBTAT00000053811 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQYGGAPGGPAFPGQTQDPLYGYFAAVAGQDGQIDADELQRCLTQSGIAGGYKPFNLETC
RLMVSMLDRDMSGTMGFNEFKELWAVLNGWRQHFISFDSDRSGTVDPQELQKALTTMGFR
LSPQAVNSIAKRYSTNGKITFDDYIACCVKLRALTDSFRRRDTAQQGVVNFPYDDFIQCV
MSV
Download sequence
Identical sequences Q0IIA3
ENSBTAP00000052219 NP_001068818.1.59421 NP_001068818.1.76553 XP_005976672.1.78601 XP_006055311.1.26621 XP_010853651.1.44457 XP_012031633.1.66739 ENSBTAP00000052219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]