SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000052299 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000052299
Domain Number 1 Region: 370-478
Classification Level Classification E-value
Superfamily SRCR-like 3.14e-45
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000762
Further Details:      
 
Domain Number 2 Region: 594-702
Classification Level Classification E-value
Superfamily SRCR-like 3.92e-43
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0001
Further Details:      
 
Domain Number 3 Region: 26-133
Classification Level Classification E-value
Superfamily SRCR-like 4.19e-35
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00027
Further Details:      
 
Domain Number 4 Region: 237-344
Classification Level Classification E-value
Superfamily SRCR-like 7.59e-32
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0051
Further Details:      
 
Domain Number 5 Region: 477-583
Classification Level Classification E-value
Superfamily SRCR-like 4.05e-30
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0018
Further Details:      
 
Domain Number 6 Region: 134-237
Classification Level Classification E-value
Superfamily SRCR-like 1.96e-29
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000052299   Gene: ENSBTAG00000024318   Transcript: ENSBTAT00000051899
Sequence length 937
Comment pep:known chromosome:UMD3.1:5:102940224:102966384:1 gene:ENSBTAG00000024318 transcript:ENSBTAT00000051899 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALGRHLSLQGLCVLLLGTMVGGQDLELRLKDGTHRCEGRVEVKHQGQWGTVNDYGWGLE
EAAVVCRQLRCGAAVEAPRGAYFGPAAGPIWFYYVLCGGTESALTECQYSSIRDFSEDGF
IHDWDAGAVCSGFVRLAGGARPCSGRVEVHSEQDWIPVSDRNFALPTAQVICAELGCGKA
VSVLGHVPFRESDGQVWAEEFRCEGKEPELWSCPRMPCPGGTCHHSGAAQVVCSAYSEVR
LMTNGSFQCEGQVEMNISGQWRALCASHWTLANANVVCHQLGCGVAISTPRGPHFMEGVD
QISTVRFHCLGVESFLWECPVTALGVPDCSHGNTASVICSGNQTQVLPQCKYPVSEPAAS
ASPEESAPYCSDSRQLRLVDGGGHCAGRVEILDQGSWGTICDDGWDLDDARVVCRQLGCG
EALYATRSAHFGAGSGPIWLDDLNCTGKESHVWRCPSRGWGQHDCRHKQDAGVICSDFLA
VRMVRKDQECAGWLEVFYNGTWGSICRSPMEDITVSMICRQLDCGNSGSLTTSVALREGS
RPRWVDRIRCQKTDTSLWQCPSDPWNYNSCYPKDEAYISCAGGKHKSCPTAAPCTDREKL
RLRGGDSECSGRVEVWHSGSWGTVCDDSWSLAEAEVVCQQLGCGPALEAVPAATFGPGNG
SIWLDEVRCGGRESSLWDCAAEPWGQSDCKHEEDAGVRCSAPDPGILSLPMIICIILGAL
LFMVLIILGIQLHRWRAEHQELSDFEAAVDEAVYQEIDDIIKPGKKDLLDSQGNLSDDSA
TKLPYYTGDDGEDGDPDSASDPLRQRINTTGNGYDDVDELPVPVNLFFPGMNENNFSPED
RGGARYSQTKPPGQNINTIGNGYDDVDELPVPINPFFPGMNENNFFPDDRGGARYSQTGM
SLKSLRETVDSGVEEKESSLVLRQEEPGYDDVELSTM
Download sequence
Identical sequences E1B813
XP_003586180.1.76553 XP_015318980.1.59421 ENSBTAP00000052299 ENSBTAP00000050909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]