SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000052308 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000052308
Domain Number 1 Region: 681-934
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.63e-84
Family Eukaryotic proteases 0.00018
Further Details:      
 
Domain Number 2 Region: 56-305
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.74e-82
Family Eukaryotic proteases 0.0000548
Further Details:      
 
Domain Number 3 Region: 398-608
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.46e-57
Family Eukaryotic proteases 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000052308   Gene: ENSBTAG00000038520   Transcript: ENSBTAT00000054325
Sequence length 935
Comment pep:novel chromosome:UMD3.1:6:85614106:85716159:-1 gene:ENSBTAG00000038520 transcript:ENSBTAT00000054325 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLIFRFPSTEDPETINKIIQHVLHEKLQDAVGPPKLDPESVEIKKINKTETDNFLNNCC
GTRRNKTPGQSLRIVGGTEVQEGEWPWQTSLQWDGIHRCGATLINDTWLVSAAHCFRTYK
DPARWTASFGVTIYPPKMRRALRRIIVHEKYKYPSHDYDISVLELSRPVPYTNAVHKICL
PDASHEFRPGDEMFVTGFGALQNDEGSSQNHLRQVQVDLIDAKICNAPQAYNNAITPTML
CAGSLKGNKDACQGDSGGPLVSPDARDIWYLAGIVSWGDECGQPNKPGVYTKVTTFRDWI
TSKTGSIQIACVVPTLTTVPAVPSYALTGHLETLPGQFFFKWTFLPTEIYEHPFSQAKPK
YCKCKISCQKPLASPGEVEELKSGDIRWEKKKKQGKKMIGFCPSTSLGNRWLLSAAHCFA
RKNHSEDWTVDFGTIVNKPYMTRKVQNIIIHENFSGPGIHDDIAVVQLAEEHVRKICLPE
AKMKLSANDSVVVTGWGTLYMNGLLPVILQQAFLKIIDNVCNAPYALSGLVTDTMLCAGF
MSGEVDACQNDSGGPLAYSNSRNIWHLVRIVSAGEGCGKKNKPGVYTRVTAYHDWITSKM
SKAPHQFCRPVTFSRTSLPLSPPKLHSCGMYVPETFSLEKGECCSPTALSRNVLLNSIAP
RALSTKNTNKKPKPNPSKPCTATYHHQPQGCGRRPRMSATYDRIRGGSTAQEGEWPWQAS
LKKNGQHYCGASLISDRYLLTAAHCFKNSQDPRNYTVTFGTRVNLPYMQHYVQQIFIHEN
YIRGELHDDIAVILLTEKVLFKNDVHSVCLPEATQIFPPGEGVVVTGWGALSYDGEYPVL
LQKAPVKIIDTNTCNAWEAYNGMIQDTMLCAGYLEGNIDACQGDSGGPLVHPNSRNIWYL
VGIVSWGTECGTVNKPGVYTRVTAYRNWIASKTGI
Download sequence
Identical sequences F1N633
ENSBTAP00000052308 ENSBTAP00000052308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]