SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000052345 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000052345
Domain Number 1 Region: 218-310
Classification Level Classification E-value
Superfamily EF-hand 2.67e-27
Family Eps15 homology domain (EH domain) 0.00000752
Further Details:      
 
Domain Number 2 Region: 112-215
Classification Level Classification E-value
Superfamily EF-hand 5.36e-27
Family Eps15 homology domain (EH domain) 0.00000524
Further Details:      
 
Domain Number 3 Region: 16-105
Classification Level Classification E-value
Superfamily EF-hand 2.83e-20
Family Eps15 homology domain (EH domain) 0.0000145
Further Details:      
 
Domain Number 4 Region: 335-448
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000000366
Family Myosin rod fragments 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000052345   Gene: ENSBTAG00000005542   Transcript: ENSBTAT00000053382
Sequence length 910
Comment pep:known chromosome:UMD3.1:3:95389092:95528688:1 gene:ENSBTAG00000005542 transcript:ENSBTAT00000053382 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAAQLSLTQLSSGNPLYEKYYRQVDTGNTGRVLASDAAVFLKKSGLPDLVLGKIWDLA
DTDGKGILNKQEFFVALRLVACAQNGLEVSLSSLNLAVPPPRFHDTSSPLLISGTSAAEL
PWAVKPEDKAKYDAIFDSLCPVNGFLSGDKVKPVLLNSKLPVDILGRVWELSDIDHDGML
DRDEFAVAMFLVYCALEKEPVPMSLPPALVPPSKRKTWIVSPAEKAKYDEIFLKTDKDMD
GFVSGLEVREIFLKTGLPSALLAHIWALCDTKNCGKLSKDQFALAFHLINQKLIKGIDPP
HILTPEMIPPSDRATLQKNIIGSSPVADFSAIKELDTLNNEIVDLQREKNNVEQDLKEKE
DAVKQRTSEVQDLQDEVQRENTNLQKLQAQKQQVQELLDGLDEQKAQLEEQLQEVRKKCA
EEAQLISSLKAELTSQESQISTYEEELAKAREELSRLQQETAELEESVESGKAQLGPLQQ
HLQDSQQEISSMQMKLVEMKELENHSNQLNWCSSPHSILVNGATDYCSLSTSSSETANLN
EHTEGQSNLESEPIHEESPARSSPEVLPSCVTDENEEVTVAVNEKVCPEFNSDRCSKEED
PFNVETSSLTNPVADSHLDFFQSDPFVGSDPFKDDPFGKIDPFGGDPFKGSDPFASDCFF
KQSSTDPFATSSTDPFSEASNSSNTSVEMLKHNDPFAPGGTVVVAASDSATDPFASVFGS
ESFEDGFADFSTLSKVNSESTSFQTKVNNEDPFSSATSSSISSVAVTKNMLEETSVKNED
VPPALPPKIGTPTRPCPPPPGKRPINKMDSSDPFKLNDPFQPFPGNDSPKEKDPDMFCDP
FTSTTTTTNKEADPSNFANFSAYPSEEDMIEWAKRESEREEEQRLARLNQQEQEDLELAI
ALSKSEISEA
Download sequence
Identical sequences A5D7I1
ENSBTAP00000052345 NP_001091556.1.59421 NP_001091556.1.76553 ENSBTAP00000052345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]