SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000052473 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000052473
Domain Number 1 Region: 582-690
Classification Level Classification E-value
Superfamily SRCR-like 5.62e-45
Family Scavenger receptor cysteine-rich (SRCR) domain 0.000074
Further Details:      
 
Domain Number 2 Region: 806-916
Classification Level Classification E-value
Superfamily SRCR-like 1.7e-42
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0001
Further Details:      
 
Domain Number 3 Region: 36-139
Classification Level Classification E-value
Superfamily SRCR-like 1.44e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000851
Further Details:      
 
Domain Number 4 Region: 244-348
Classification Level Classification E-value
Superfamily SRCR-like 4.45e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00012
Further Details:      
 
Domain Number 5 Region: 689-796
Classification Level Classification E-value
Superfamily SRCR-like 1.07e-30
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0018
Further Details:      
 
Domain Number 6 Region: 138-245
Classification Level Classification E-value
Superfamily SRCR-like 3.01e-29
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0017
Further Details:      
 
Domain Number 7 Region: 349-454
Classification Level Classification E-value
Superfamily SRCR-like 1.83e-27
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0019
Further Details:      
 
Domain Number 8 Region: 457-550
Classification Level Classification E-value
Superfamily SRCR-like 2.22e-26
Family Scavenger receptor cysteine-rich (SRCR) domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000052473   Gene: ENSBTAG00000039817   Transcript: ENSBTAT00000055624
Sequence length 1092
Comment pep:novel chromosome:UMD3.1:5:102393240:102427984:1 gene:ENSBTAG00000039817 transcript:ENSBTAT00000055624 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVSSGNQTQVLPQCNDSMAEPAGSWASEESAPYCSELCLVEGAGPCAGRVEILDQGSWGT
ICDDGWDLDDAHVVCRQLGCGEALNATGSAHFGAGSGPIWLDDLNCTGKESHVWRCPSRG
WGQHNCRHKQDVGVICSEFLALRMVSEDQQCAGWLEVFYNGTWGSVCCNPMEDITVSIIC
RQLGCGDSATLNSSVDLREGSRPQWVDRIHCWKTDTSLWPCPSDPWNYTSCSPKEEAYIS
CAGSRQLRLVDGGGPCAGRVEILNQGSWGTICDYSWSMKDARVVCRQLGCGKALYATLSS
SFGAGSGPIWLDNMKCTGKESVWRCPSRGWGKHYCDHSEDAGVICSGFVGLAGGDGPCSG
RVEVHSGEAWIPVSDGNFTLPTAQVICAELGCGKAVSVLGHVPFRESDGRVWAEEFRCEG
EEPKLWWCPRVPCPGGTCHYSGAAQVVCSVYTDVWLMTNGSSLCEGQVEMNISGQWRALC
APHWNLANANVVCYQLGCGVAISTPNGAEGSDQLWKARFHCSGTESFLWKCPVTALGVPD
CSHDNTASVIFAGNQTQVLPQCDHFVSEPAGSAASEDSAPYCSDSRQLRLVDGGGPCAGR
VEILDQGSWGTICDDGWDLDDARVVCRQLGCGVALNATGSAHFAAGSGPIWLDDLNCTGK
ESHVWTCPSRGWGRHDCRHKEDAGVICSEFLALRMVSEDQPCAGWLEVFYNGTWGSVCRS
PMDDVTVSIICRQLGCGDSGSLNTSVGLREGSRPRWVDLIQCRKMDTSLWHCPSGPWKYS
SCSPKEEAYVSCAGRRPKSCPTAASCTDREKLRLRGGDSECSGRVEVWHSGSWGTVCDDS
WSLAEAEVVCQQLGCGQALEAVQAAGFGPGNGSIWLDEVWCRGRESSLWDCAEEPWEQSD
CKHEEDAGVRCSGERTLPTTTAGTRTTSNSLPGIFSLPGVLCLILGSLLFLVLIILVTQL
LRWRAEHRALSSYEDALAEAVYEELDYLLTQKEGLGSPDQRTDVPAENYDNAEEVPVPGT
PSASQGNEEEVPPEKEDGVRSSQTGSCLNFSREAADPGEGEESFWLLQGKKGDPGYDDVE
LSALGTSPVTFS
Download sequence
Identical sequences F1N6N9
ENSBTAP00000052473 ENSBTAP00000052473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]