SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000052480 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000052480
Domain Number 1 Region: 292-405
Classification Level Classification E-value
Superfamily SH2 domain 7.4e-22
Family SH2 domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000052480   Gene: ENSBTAG00000038340   Transcript: ENSBTAT00000057073
Sequence length 426
Comment pep:known_by_projection chromosome:UMD3.1:6:110394526:110603524:-1 gene:ENSBTAG00000038340 transcript:ENSBTAT00000057073 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRPGNRKIAKEGASDLKFQNFALLKNRSWPRIDSATGQYQTINEPLLLDGERNSMAVLD
GAKGHTGDDYEDPELHVGEDWQSLKILPARPIKESEYADTRYFRGMMDTPLSLDSKTSLP
TDRLTWMKLEEVEKPISKDIRKQHVKGDKPTKGNKTPLPPPRPPVKPPKKYQPLPPEPPS
SRPPFPQRHTFPEAQKGARQISLKNLSEVLGTEKVPYHQMKPEAPHLPQNQSPQEIPLAV
ASSSFMTRNPTVQNRDHKESMPSYAPQRCQSPAGSGPQENPLLHKITSRKKPFPRRSDGK
DVQHNEWYIGEYSRQAVEEALMKENKDGTFLVRDCSAKSRAEPYVLVVFYGNKVYNVKIR
FLERNQQFALGTGLRGDEKFDSVEAIIEHYKYFPIILIDGKDKTGTHREQCYLTQALPVN
RHFSPR
Download sequence
Identical sequences E1BAT4
XP_002688505.1.76553 XP_003582400.1.59421 9913.ENSBTAP00000052480 ENSBTAP00000052480 ENSBTAP00000052480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]