SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000052532 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000052532
Domain Number 1 Region: 2-106
Classification Level Classification E-value
Superfamily Globin-like 7.41e-36
Family Globins 0.00000382
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000052532   Gene: ENSBTAG00000039056   Transcript: ENSBTAT00000056194
Sequence length 149
Comment pep:novel chromosome:UMD3.1:15:49039183:49040188:1 gene:ENSBTAG00000039056 transcript:ENSBTAT00000056194 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVHFTGEEKAAITDLWGKMNMEEAGGEALGRLLVFYPWTQRFFDSFGNLSSASAIMGNPK
VKAHGKKVLTSFGEAMKNSDNLKGAFAKLSELHCDKLHGDPENFRVSLGSVRVFPVAFYF
AVIITALSLFKNFQKLLSEVDVSTPRKYQ
Download sequence
Identical sequences E1B976
9913.ENSBTAP00000052532 ENSBTAP00000052532 ENSBTAP00000052532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]