SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000052557 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000052557
Domain Number 1 Region: 23-168
Classification Level Classification E-value
Superfamily EF-hand 8.33e-49
Family Calmodulin-like 0.00000123
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000052557   Gene: ENSBTAG00000012320   Transcript: ENSBTAT00000016356
Sequence length 172
Comment pep:known chromosome:UMD3.1:24:35870001:35870886:1 gene:ENSBTAG00000012320 transcript:ENSBTAT00000016356 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSYRKPTVASTSQKRKVGPKPELTEEQKQEVREAFDLFDADGSGTIDVKELKVAMRAL
GFEPRKEEMKRMIADVDKEGTGKISFNDFLAVMTQKMAEKDTKEEILKAFRLFDDDETGK
ISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVNEDEFLRIMKKTNLY
Download sequence
Identical sequences L8IF28 Q32LE3
NP_001072974.1.59421 NP_001072974.1.76553 XP_005898952.1.15283 XP_010827204.1.44457 XP_019842035.1.53367 9913.ENSBTAP00000052557 ENSBTAP00000052557 ENSBTAP00000052557

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]