SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000052853 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000052853
Domain Number 1 Region: 239-347
Classification Level Classification E-value
Superfamily SRCR-like 1.24e-45
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000614
Further Details:      
 
Domain Number 2 Region: 794-902
Classification Level Classification E-value
Superfamily SRCR-like 2.09e-45
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000648
Further Details:      
 
Domain Number 3 Region: 451-557
Classification Level Classification E-value
Superfamily SRCR-like 7.85e-43
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000851
Further Details:      
 
Domain Number 4 Region: 1018-1129
Classification Level Classification E-value
Superfamily SRCR-like 1.09e-42
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000866
Further Details:      
 
Domain Number 5 Region: 107-213
Classification Level Classification E-value
Superfamily SRCR-like 8.89e-32
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0035
Further Details:      
 
Domain Number 6 Region: 346-452
Classification Level Classification E-value
Superfamily SRCR-like 8.24e-31
Family Scavenger receptor cysteine-rich (SRCR) domain 0.002
Further Details:      
 
Domain Number 7 Region: 899-1008
Classification Level Classification E-value
Superfamily SRCR-like 3.4e-30
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0019
Further Details:      
 
Domain Number 8 Region: 666-767
Classification Level Classification E-value
Superfamily SRCR-like 3.53e-30
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0063
Further Details:      
 
Domain Number 9 Region: 558-660
Classification Level Classification E-value
Superfamily SRCR-like 4.19e-29
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0013
Further Details:      
 
Domain Number 10 Region: 3-107
Classification Level Classification E-value
Superfamily SRCR-like 1.7e-28
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000052853   Gene: ENSBTAG00000026531   Transcript: ENSBTAT00000052415
Sequence length 1305
Comment pep:known chromosome:UMD3.1:5:103375408:103426531:-1 gene:ENSBTAG00000026531 transcript:ENSBTAT00000052415 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GFVRLAGGDGPCSGRVEVHSGEAWIPVSDGNFTLATAQIICAELGCGKAVSVLGHELFRE
SSAQVWAEEFRCEGEEPELSVCPRVPCPGGTCHHSGAAQVVCSAYSEVRLMTNGSSQCEG
QVEMKISGRWRALCASHWSLANANVICRQLGCGVAISTPGGPHLVEEDDQILTARFHCSG
AESFLWSCPVTALGGPDCSHGNTASVICSGNQIQVLPQCNDSLSQPAGSSASEESAPYCS
DSRQLRLVDGGGPCAGRVEILDQGSWGTICDDGWDLDDARVVCRQLGCGEALNATGSAHF
GAGSGPIWLDNLNCTGKESHVWRCPSRGWGQHNCRHKQDAGVICSEFLALRMVSEDQQCA
GWLEVFYNGTWGSVCRSPMEDITVSMICRQLGCGDSGTLNSSVALREGFRPQWVDGIQCR
KTDTSLWQCPSDPWNYTSCSPKEEAYIWCADSRQIRLVDGGGRCSGRVEILDQGSWGTIC
DDRWDLDDARVVCRQLGCGEALDATISSSFGRGSGPIWLDEVNCRGEESQVWRCPTWGWQ
QHNCDHQEDAGVICSGFVRLAGGDGPCSGRVEVHSGEAWTPVSDGNFTLPTAQVICAELG
CGKAVSVLGHMPFRESDGQVWAEEFRCDGGEPELWSCPRVPCPGGTCLHSGAAQVVCSVY
TEVQLMKNGTSQCEGQVEMKISGRWRALCASHWSLANANVVCRQLGCGVAISTPRGPHLV
EGGDQISTARFHCSGAESFLWSCPVTALGGPDCSNGNTASVICSGNHTQVLPQCNDFLSQ
PAGSAASEESAPYCSDSRQLRLVDGGGPCAGRVEILDQGSWGTICDDGWDLDDARVVCRQ
LGCGEALNATGSAHFGAGSGPIWLDDLNCTGKESHVWRCPSRGWGRHDCRHKEDAGVICS
EFLALRMVSEDQQCAGWLEVFYNGTWGSVCRSPMEDITVSVICRQLGCGDSGSLNTSVGL
REGSRPRWVDLIQCRKMDTSLWQCPSGPWKYSSCSPKEEAYISCEGRRPKSCPTAAPCTD
REKLRLREGDSECSGRVEVWHSSSWGTVCDDSWSLAEAEVVCQQLGCGQALEAVRSAAFG
PGNGSIWLDEVQCGGRESSLWDCAAEPWGQSDCKHEEDAGVRCSGVRTTLPTTTAGTRTT
SNSLPGVFSLPGVLCLILGSLLFLVLIILVTQLLRWRAERRALSSYEDALAEAVYEELDY
LLTQKEGLGSPDQTTDVPDENYDDAEEVPVPGTPSPSQGNEEEVPPEKEDGVRSSQTGSC
LNFSREAADPGEEEESFWLLQGKKGDAGYDDVELSALGTSPMTFS
Download sequence
Identical sequences F1N4G4
ENSBTAP00000052853 ENSBTAP00000052853

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]