SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000052855 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000052855
Domain Number 1 Region: 38-288
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.49e-79
Family Eukaryotic proteases 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000052855   Gene: ENSBTAG00000040038   Transcript: ENSBTAT00000055920
Sequence length 324
Comment pep:novel chromosome:UMD3.1:8:8621813:8633235:1 gene:ENSBTAG00000040038 transcript:ENSBTAT00000055920 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRWRDGRAMLLLPVALLLRWPHSSLERSCFRRAGERCLQCGQKMNTSEKSEVLEIIGGV
PANIRDFPWQIRILENGSHLCGGSILSEWWILTAAHCFKSKNAIRSTLEVTHGEENLDTQ
NLTKIKVDKLIIHNYFDSWFYLNDIALLLLKSPLSLGVRKVPICLSEVTAIERWRNCWVS
GWGTTGSVPQRSTETGLQKVNIQLIKWETCFELMPLLTKSMLCAGDLEGGKDACQGDSGG
PLVCQKKTRKSKWYQLGIVSWGVGCGQKKQPGVYTQVSSYLSWIETKTKLSKRPYKHEPD
SGYSLLLSPWAILVLYFLMFLLSP
Download sequence
Identical sequences F1N4G1
ENSBTAP00000052855 ENSBTAP00000052855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]