SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053019 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053019
Domain Number 1 Region: 120-622
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.98e-158
Family Calponin-homology domain, CH-domain 0.00000000222
Further Details:      
 
Domain Number 2 Region: 5-95
Classification Level Classification E-value
Superfamily EF-hand 2.96e-18
Family Calmodulin-like 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053019   Gene: ENSBTAG00000023429   Transcript: ENSBTAT00000049695
Sequence length 630
Comment pep:known chromosome:UMD3.1:1:127323050:127416649:-1 gene:ENSBTAG00000023429 transcript:ENSBTAT00000049695 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENSTTTISREELEELQEAFNKIDIDNSGYVSDYELQDLFKEASLPLPGYKVREIVEKIL
AVADNNKDSRISFEEFVSLMQELKSKDISKTFRKIINKREGITAIGGTSSISSEGTQHSY
SEEEKVAFVNWINKALENDPDCKHLIPMNPNDDSLFKSLADGILLCKMINLSEPDTIDER
AINKKKLTPFTISENLNLALNSASAIGCTVVNIGAQDLTEGKPHLVLGLLWQIIKVGLFA
DIEISRNEALIALLKEGEDLEELMRLSPEELLLQWVNYHLTNAGWPTISNFSHDIKDSRA
YFHLLNQIAPKGDRDDGPAIAIDLTGFSEKNDLKRAEFMLQEADKLGCRQFVTPADVVSG
NPKLNLAFVANLFNTYPGLHKPDNNDIDVNLLEGESKEERTFRNWMNSLGVNPYINHLYS
DLADALVIFQLYEMIRVPVDWSHVNKPPYPALGGNMKKIENCNYAVELGKNKAKFSLVGI
AGQDLNEGNSTLTLALVWQLMRRYTLNVLSDLGEGEKVNDAIIIEWVNQTLKSANKNTFI
SSFKDKSISTSLPVLDLIDAIAPNAVRQEMIKREDLSDEDKLNNAKYAISVARKIGARIY
ALPDDLVEVKPKMVMTVFACLMGKGLNKIK
Download sequence
Identical sequences A6H742 L8J1D5
NP_001096769.1.59421 NP_001096769.1.76553 XP_005888823.1.15283 XP_010799858.1.76553 XP_010799860.1.76553 XP_010856456.1.44457 XP_010856457.1.44457 XP_015328779.1.76553 ENSBTAP00000053019 ENSBTAP00000053019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]