SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053065 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053065
Domain Number 1 Region: 11-144
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.18e-27
Family Eukaryotic proteases 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053065   Gene: ENSBTAG00000038291   Transcript: ENSBTAT00000055085
Sequence length 144
Comment pep:known chromosome:UMD3.1:8:8603817:8614097:1 gene:ENSBTAG00000038291 transcript:ENSBTAT00000055085 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSRTLKDSRLERKQVQKIIIHKDYEPPHLDSDLSLLLLATPVQFNNFKMPICLQKKEKI
WGRCWMTEWVMAPSYDRKDNFNMYLQKLRVVQITWRDCSQRVDHLSRNMLCAWQELGTKG
NCQGDSGAPMVCTIHGSRRLFQVG
Download sequence
Identical sequences E1B9E7
ENSBTAP00000053065 ENSBTAP00000053065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]