SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053077 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053077
Domain Number 1 Region: 27-291
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.85e-85
Family Eukaryotic proteases 0.0000605
Further Details:      
 
Domain Number 2 Region: 601-808
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.04e-32
Family Eukaryotic proteases 0.0013
Further Details:      
 
Domain Number 3 Region: 326-556
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.47e-32
Family Eukaryotic proteases 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053077   Gene: ENSBTAG00000037397   Transcript: ENSBTAT00000055283
Sequence length 855
Comment pep:known_by_projection chromosome:UMD3.1:25:27492856:27501201:-1 gene:ENSBTAG00000037397 transcript:ENSBTAT00000055283 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQHLLLPLVILAISPIPEAFQDSALSPTQEEPEDLDCGRPKPSARIVGGSDSQPGTWPW
QVSLHHGGGHICGGSLIAPSWVLSAAHCFVTNGTLEPAAEWSVVLGVHSQDGPLDGAHVR
AVAAILVPDNYSSVERGADVALLRLASPARLGPSVRPVCLPRASHRFAQGTACWATGWGD
VQEEDPLPLPWVLQEVELRLLGEAACQCLYSRPGPFNLTFQLLPGMLCAGYREGRRDTCQ
GDSGGPLVCKEGGRWFQAGITSFGFGCGRRNRPGVFTAVAPYEAWIREQVSGSEPGPAFP
TQSPEAQSGLPEPMNENCTIALPECGRAPRPGAWPWEAQVMVPGSRPCYGALVSESWVLA
PASCFPGHISSARPPSDLDYWRVQLPSRPRAEQVARLVPHENASWDDASNLALLQLRAPV
NLSAAPRPVCLPHPEHYFLPGSRCRLARWGRGEPAPGASSLLEAELLSAWWCHCLYGRQG
ASVPPPGEPPQALCPAYQEEEAEGSCWNYSHWSLLCREEGTWFLAGIRDLPSDCLRPRVF
YPLQTHGPWISHVTRGAYLEDQLAWDWGPEGEETEAQTCPPHTENGACGLQPEPAPMGVL
WPWLAEVHVAGERVCAGVLVAPGWVLAATHCVLRPGSTTVPYIEVYLGRAGASPLPQSHQ
VSRLVISIHLPRHLGLRPPLALLELSSRVEPSPSALPICLHPGGTPLGASCWVLGWKDPQ
DRVPVAAAVSILTPRLCHCLYQGLLPPGTLCVLYAEGQEDRCEVTSAPPLLCQTEGGSWV
LVGMAVRGSRELFAATGPEEAWISQTVGEAPFLPPSGFPHWLPEGSDLCPPDMARASGSP
RAALFLLLLTPLIQG
Download sequence
Identical sequences E1B982
ENSBTAP00000053077 ENSBTAP00000053077 9913.ENSBTAP00000053077 XP_015315886.1.76553 XP_015324866.1.59421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]