SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053158 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053158
Domain Number 1 Region: 26-370
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.22e-46
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000148
Further Details:      
 
Domain Number 2 Region: 378-504
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 3.09e-26
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.0000276
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053158   Gene: ENSBTAG00000043581   Transcript: ENSBTAT00000060561
Sequence length 506
Comment pep:known chromosome:UMD3.1:17:74887191:74913312:-1 gene:ENSBTAG00000043581 transcript:ENSBTAT00000060561 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGLQGAQKRFRAAAPPGSAGPAGRQCYDLLVIGGGSGGLACAKEAAQLGKKVAVLDYVEP
SPQGTRWGLGGTCVNVGCIPKKLMHQAALLGGMIRDAPHYGWGVAQAPHSWATLADAVQN
HVKSLNWGHRIQLQDRKVKYFNVKASFVDTHTVCGVSKGGEETLLSAEHIVIATGGRPRY
PTHIEGALEYGITSDDLFWLKESPGKTLVVGASYVALECAGLLTGLGLDTTVMIRSVPLR
AFDQQMASLVTEHMAGHGTRILRGCAPEKVEKLPGQQLRVTWVDLTSDRKDAGTFDTVLW
AIGRVPETASLNLEKAGVHTNPVTGKILVDAQETTSVPHIYAIGDVAEGRPELTPTAIMA
GRLLAQRLSGRTSDLMDYSSVPTTVFTPLEYGCVGLSEEAAVARHGEEHVEIHHKGPGTC
VVAFRDVVLCFTMLSCLRYPXQLVLGLHFLGPNAGEVIQGFALGIKCGASYQQLMRTVGI
HPTCAEEVAKLRISKRSGLDPTVTGC
Download sequence
Identical sequences F1MN10
ENSBTAP00000053158 ENSBTAP00000053158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]