SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053176 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053176
Domain Number 1 Region: 5-99,129-156
Classification Level Classification E-value
Superfamily EF-hand 1.29e-41
Family EF-hand modules in multidomain proteins 0.0016
Further Details:      
 
Domain Number 2 Region: 435-590
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 1.55e-30
Family Diacylglycerol kinase-like 0.015
Further Details:      
 
Domain Number 3 Region: 131-221
Classification Level Classification E-value
Superfamily EF-hand 8.64e-22
Family Calmodulin-like 0.015
Further Details:      
 
Domain Number 4 Region: 225-295
Classification Level Classification E-value
Superfamily Cysteine-rich domain 5.98e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0031
Further Details:      
 
Domain Number 5 Region: 298-362
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000209
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053176   Gene: ENSBTAG00000021905   Transcript: ENSBTAT00000061250
Sequence length 590
Comment pep:known_by_projection chromosome:UMD3.1:4:22333433:23127587:-1 gene:ENSBTAG00000021905 transcript:ENSBTAT00000061250 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTNQEKWAHLSPSEFSQLQKYAEYSTKKLKDVLEEFHGNGVLAKYNPEGKQDILNQTIDF
EGFKLFMKTFLEAELPDDFTTHLFMSFSNKFPHSSPMVKSKPALLSSGLKMNKGAITPPR
TSPANTCSPEVIHLKDIVCYLSLLERGRPEDKLEFMFRLYDTDGNGFLDSSELENIISQM
MHVAEYLEWDVTELNPILHEMMEEIDYDHDGTVSLEEWIQGGMTTIPLLVLLGLENNVKD
DGQHVWRLKHFNKPAYCNLCLNMLIGVGKQGLCCSFCKYTVHERCVARAPPSCIKTYVKS
KKNTDVMHHYWVEGNCPTKCDKCHKTVKCYQGLTGLHCVWCQITLHNKCASHLKPECDCG
PLKDHILPPTTICPVVLQTLPTSGVSAPEERQATVKREKGSSQQSNKVTDKNKMQRANSV
TVDGQGLQITPVPGTHPLLVFVNPKSGGKQGERIYRKFQYLLNPRQVYSLAGNGPMPGLN
FFRDVPDFRVLACGGDGTVGWILDCIEKANVVKHPPVAILPLGTGNDLARCLRWGGGYEG
ENLMKILKDIENSTEIMLDRWKFEVIPNDKDEKGDPVPYSIINNYFSIGV
Download sequence
Identical sequences E1B7U7
ENSBTAP00000053176 ENSBTAP00000053176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]