SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053189 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053189
Domain Number 1 Region: 1104-1243,1321-1588
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.55e-109
Family Myotubularin-like phosphatases 0.00000536
Further Details:      
 
Domain Number 2 Region: 1643-1846
Classification Level Classification E-value
Superfamily PH domain-like 4.82e-30
Family Pleckstrin-homology domain (PH domain) 0.0000235
Further Details:      
 
Domain Number 3 Region: 875-1017
Classification Level Classification E-value
Superfamily PH domain-like 2.05e-16
Family GRAM domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053189   Gene: ENSBTAG00000043981   Transcript: ENSBTAT00000061615
Sequence length 1849
Comment pep:known chromosome:UMD3.1:15:42970987:43480700:1 gene:ENSBTAG00000043981 transcript:ENSBTAT00000061615 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARLADYFIVVGYDHEKPGSGAGLGKIIQRFPQKDWDDTPFPQGIELFCQPGGWQLSRER
KQPTFFVVVLTDIDSDRHYCSCLTFYEAEINLQGTKKEETEGEVEVSGLIQPAEVFAPKS
LVLVSRLDYPEIFRACLGLIYTVYVDSLNVSLESLIANLCACLVPAAGGSQKLFSLGAGD
RQLIQTPLHDSLPVTGTSVALLFQQLGIQNVLSLFCAVLTENKVLFHSASFQRLSDACRA
LESLMFPLKYSYPYIPILPAQLLEVLSSPTPFIIGVHSVFKTDVHELLDVIIADLDGGTI
KIPECIHLSSLPEPLLQQTQAALSLILHPDLEVADHAFPPPRTALSHSKMLDKEVRAVFL
RLFAQLFQGYRSCLQLIRIHAEPVIHFHKTAFLGQRGLVENDFLTKVLNGMAFAGFVSER
GPPYRSCDLFDEVVAFEVERIKVEENNPMKMIKHVRELAEQLFKNENPNPHMAFQKVPRP
TEGSHLRVHILPFPKINETRVQELIQENLAKNQNAPPASRVEKKCVVPAGPPVVSIMDKV
TTVFNSAQRLEVVRNCISFIFENKTLETEKTLPAALRALKGKAARQCLTDELGLHVQQNR
AILDHQQFDYIIRMMNCTLQDCSSLEEYNIAAALLPLTSAFYRKLAPGVSQFAYTCVQDH
PIWTNQQFWETTFYNAVQEQVRSLYLSAKEDNHALHLKQKDKLPDDQYQEKTAMDLAAEQ
LRLWPTLSKSTQQELVQREESTVFSQAIHFANLMVNLLVPLDSSKNKLLRASAPGDWESG
SNSIVTNSIAGSVAESYDTESGFEDSENNDIANSVVRFITRFIDKVCTESGVTQDHIKSL
HCMIPGIVAMHIETLEAVHRESRRLPPIQKPKILRPALLPGEEIVCEGLRVLLDPDGREE
ATGGLLGGPQLLPAEGALFLTTYRILFRGTPHDQLVGEQTVVRSFPIASITKEKKITMQN
QLQQNMQEGLQVTSASFQLVKVAFDEEVSPEVVEVFRKQLMKLRYPQSVFTTFAFAAGQT
APQIISPKQKEKNTSFRTFSKTIVKGAKRAGKMTIGRQYLLKRRTGTIVEERVSRPGWNE
DDDVSVSDDSELPTSTTLKASEKSTMEQLVEKACFRDYQRLGLGTISGSSSRSKPEYFRI
TASNRMYSLCRSYPGLLVVPQAVQDSSLPRVARCYRHNRLPVVCWRNSRSSTLLLRSGGF
HGKGVVGLFKSQNSPQAAPTSSLESSSSIEQEKYLQALLSAVSVHQKLSGNNPLTVRPAL
ALSPGVWASLRSSTRLISSPTSFIDVGARLAGKDHSTSFSNSTYLQNQLLKRQATLYIFG
EKSQLRNFKLEFALNCEFVPVEYHDIRQVKASFKKLMRACVPSAIPTDSEVTFLRALGDS
EWFPQLHRILQLAVVVSEVLENGSSVLVCLEEGWDITAQVTSLVQLLSDPFYRTLEGFRM
LVEKEWLSFGHKFSQRSSLTLSCQGSGFTPVFLQFLDCVHQVHNQYPTEFEFNLYYLKFL
AFHYVSNRFKTFLLDSDYERLEHGTLFDDKGDKHAKKGICIWECIDRMHKRSPIFFNYLY
SPVEIEALKPNVNVSSLKKWDYYIEETLSTGPSYDWMMLTPKQLPSEDSELAGGARPQSQ
RRTVWPCYDDVSCAQPDALTSLFSEIERLEHKLNQTPEKWQQLWERVNVDLKEEPRADHP
QRYPSGSPGTVSTNLPFYQKRPQLHLPDSNLAEEQNTGVSPSNGVDRRAATLYSQYTPKN
DENRSFEGTLYKRGALLKGWKPRWFVLDVTKHQLRYYDSGEDTSCKGHIDLAEVEMVIPA
GPSMGAPKHTSDKAFFDLKTSKRVYNFCAQDGQSAQQWMDRIQSCISDA
Download sequence
Identical sequences F1MMR9
ENSBTAP00000053189 ENSBTAP00000053189 NP_001096707.2.59421 NP_001096707.2.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]