SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053272 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053272
Domain Number 1 Region: 191-502
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.59e-46
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0067
Further Details:      
 
Domain Number 2 Region: 71-168
Classification Level Classification E-value
Superfamily ISP domain 2.88e-26
Family Rieske iron-sulfur protein (ISP) 0.024
Further Details:      
 
Domain Number 3 Region: 506-591
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 3.43e-20
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053272   Gene: ENSBTAG00000038132   Transcript: ENSBTAT00000061578
Sequence length 598
Comment pep:known chromosome:UMD3.1:17:74307986:74318794:1 gene:ENSBTAG00000038132 transcript:ENSBTAT00000061578 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGCFSKPKPVELKIEVVLPEKDRGKEELSTGSRGSPRAYQGNGAARHFHADERLPTAHP
YPGAQDCVEAAVCHVKDLENGQMREVELGWGKVLLVKDNGELHALGHKCPHYGAPLVKGV
LSRGRVRCPWHGACFNVSTGDLEDFPGLDSLHKFQVKIEKEKVYIRASKQALQLQRRTKV
MATCISPSAGYSGSTNVLIVGAGAAGLVCAETLRQEGFSDRIVLCTLDRHLPYDRPKLSK
SLDAQPEQLALRPKEFFRAHGIEVLTEAQVVTVDVRNKKAVFKDGFKLEYSKLLLAPGSS
PKTLSCKGKDVENVFTIRTPEDANRVVRLARGRNAVVVGAGFLGMEVAAYLTEKAHSVSV
VEVEETPFRRFLGERVGHTLMKMFENNRVKFYMQTEVSELRAQEGKLKEVVLKSSKVVRA
DVCVVGIGAVPATGFLRQSGISLDSRGFIPVNKMMQTNIPGVFAAGDAVTFPLAWRNNRK
VNIPHWQMAHAQGRVAAQNMLAQEAEISTVPFLWTAMFGKSLRYAGYGEGFDDVIIQGDL
DELKFVAFYTKGDEVISVASMNYDPIVSKVAEVLASGRTIRKREVETGDMSWLTGKGS
Download sequence
Identical sequences E1BMA9
ENSBTAP00000053272 NP_001039746.2.59421 NP_001039746.2.76553 ENSBTAP00000053272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]