SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053357 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053357
Domain Number 1 Region: 1789-2034
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.38e-54
Family Ankyrin repeat 0.0000000653
Further Details:      
 
Domain Number 2 Region: 799-934
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000565
Family Growth factor receptor domain 0.0054
Further Details:      
 
Domain Number 3 Region: 1056-1167
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000204
Family Growth factor receptor domain 0.0093
Further Details:      
 
Domain Number 4 Region: 571-700
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000288
Family Growth factor receptor domain 0.0094
Further Details:      
 
Domain Number 5 Region: 388-512
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000487
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 6 Region: 928-1043
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000408
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 7 Region: 508-550
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000046
Family EGF-type module 0.0059
Further Details:      
 
Domain Number 8 Region: 159-196
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000187
Family EGF-type module 0.002
Further Details:      
 
Domain Number 9 Region: 237-284
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000586
Family EGF-type module 0.013
Further Details:      
 
Domain Number 10 Region: 200-241
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000155
Family EGF-type module 0.0052
Further Details:      
 
Domain Number 11 Region: 275-314
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000209
Family EGF-type module 0.0055
Further Details:      
 
Domain Number 12 Region: 1251-1301
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000233
Family EGF-type module 0.013
Further Details:      
 
Domain Number 13 Region: 68-207
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000251
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 14 Region: 1133-1253
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000361
Family Growth factor receptor domain 0.0073
Further Details:      
 
Domain Number 15 Region: 1341-1377
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000383
Family EGF-type module 0.03
Further Details:      
 
Domain Number 16 Region: 1477-1510
Classification Level Classification E-value
Superfamily Notch domain 0.0000000798
Family Notch domain 0.0035
Further Details:      
 
Domain Number 17 Region: 312-352
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000015
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 18 Region: 43-79
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000214
Family EGF-type module 0.033
Further Details:      
 
Domain Number 19 Region: 693-733
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000025
Family EGF-type module 0.01
Further Details:      
 
Domain Number 20 Region: 736-772
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000393
Family EGF-type module 0.012
Further Details:      
 
Domain Number 21 Region: 354-396
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000393
Family EGF-type module 0.017
Further Details:      
 
Domain Number 22 Region: 1396-1428
Classification Level Classification E-value
Superfamily Notch domain 0.00000275
Family Notch domain 0.0011
Further Details:      
 
Domain Number 23 Region: 1436-1468
Classification Level Classification E-value
Superfamily Notch domain 0.0000034
Family Notch domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053357   Gene: ENSBTAG00000043971   Transcript: ENSBTAT00000060960
Sequence length 2332
Comment pep:known_by_projection chromosome:UMD3.1:7:8930803:8970307:1 gene:ENSBTAG00000043971 transcript:ENSBTAT00000060960 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPGPRGRRPRRRRPMSPPPPLPSVRTLPLLLLLVGPGAAAPPCLDGSPCVNGGRCTQLP
SREAACLCPPGWVGERCQLEDPCHSGPCAGRGVCQSSVVAGTARFTCRCPRGFRGPDCSL
PDPCLSSPCAHGARCSVGSDGRYLCSCPPGYQGRSCRSDVDECRMGGPCRHGGTCLNTPG
SFRCQCPGGYTGPLCESPAVPCAPSPCRNGGTCRQSGDLTYDCACLPGFEGQNCEVNVDD
CPGHRCLNGGTCVDGVNTYNCQCSPEWTGQFCTEDVDECQLQPNACHNGGTCFNTLGGHS
CVCVNGWTGESCSQNIDDCATAVCFHGATCHDRVASFYCACPMGKTGLLCHLDDACVSNP
CHEDAICDTNPVNGRAICTCPPGFTGGACDQDVDECSIGANPCEHLGRCVNTQGSFLCQC
GRGYTGPRCETDVNECLSGPCRNQATCLDRIGQFTCICMAGFTGTYCEVDMDECQSSPCV
NGGVCKDRVNGFSCTCPSGFSGAMCQLDVDECASTPCRNGAKCVDQPDGYECRCAEGFEG
TVCERNVDDCSPDPCHHGRCVDGIASFSCACAPGYTGMRCESQVDECRSQPCRHGGKCLD
LVDKYLCRCPPGTTGVNCEVNTDDCASNPCTFGVCRDGINRYDCVCQPGFTGPLCNVEIN
ECASNPCGEGASCVDGENGFRCLCPPGSLPPLCLPPSHPCAQEPCSHGVCHDAPGGFRCV
CEPGWSGPQCSQSLTRDACESHPCRAGGTCTSDGMGFRCTCPPGVQGHQCELLSPCTPNP
CEHGGYCESAPGQMAVCSCTPGWQGPRCQQDVDECASPSPCGPHGTCTNLAGSFSCTCHE
GYSGPSCDQDIDDCDPNPCLNGGSCQDGVGSFSCSCLPGFAGPRCARDVDECLSSPCGSG
TCTDHVASFTCTCPPGYSGFHCEQDLPDCSPSSCFNGGTCVDGVNSFTCLCRPGYTGTHC
QHEADPCLSRPCMHGGVCTAAHPGFHCACPDGFTGAQCQTLVDWCSRSPCQNGGRCARTG
ASFYCLCPPGWSGRLCDIRSLPCREAAAQIGVPTEQLCQAGGQCVDKDSSHYCVCPEGHT
GSHCEQEMDPCLAQPCQHGGTCRGYTGGYVCECPAGYTGDNCEDDVDECASQPCQHGGIC
IDLVAHYLCSCPPGTLGVLCEINEDDCGPGPALDLGPRCLHNGTCVDLVGGFRCTCPPGY
TGLRCEGDINECRPGACHVAHTRDCLQDPGGGFRCLCHPGFTGPRCQTVLSPCESQPCQH
GGQCRPSPGPGGVLTFSCHCIPPFWGPRCERVARSCRELQCPVGVPCQQTVRGPRCACPP
GLSGPACRGSRGLTPGAANASCVTSPCLHGGSCRPEPLAPFFRCACASGWAGPRCEVPAT
MPEVSVAMPEVPEEPACPRAACEAKSGDKNCDRECNSPGCGWDGGDCSLSVSDPWRQCAA
LQCWLLFNNSRCDPACSSPACLYDNFDCRAGGRERTCNPVYEKYCADHFADGRCDQGCNT
EECGWDGLDCAGEVPALLARGVLVLTVLLPPEELLRSSADFLQRLSGILRTSLRFRLDEN
GQAMVFPYHRPGPGAESRNRRELAPEVIGSVVMLEIDNRLCLQSPENDHCFPDAQSAADY
LGALSAVERLDFPYPLRAARGEPVELPEPSVPLLPLLAASGIFLLVLLVLGVMVARRKRE
HSTLWFPEGFALHKDVAVGHKGRREPVGQDALGMKNMAKGESLMGEVATDWMDTECPEAK
RLKVEEPGVGTEDAVDCRQWTQHHLVAADIRVAPAMALTPPQGDADADGMDVNVRGPDGF
TPLMLASFCGGALEPIPTEEDEAEDTSASIISDLICQGAQLGARTDRTGETALHLAARYA
RADAAKRLLDAGADTNAQDHSGRTPLHTAVTADAQGVFQILIRNRSTDLDARMADGSTAL
ILAARLAVEGMVEELIASHADVNAVDELGKSALHWAAAVNNVEATLALLKNGANKDMQDS
KEETPLFLAAREGSFEAAKLLLDHFANREITDHLDRLPRDVAQERLHQDIVRLLDQPSGP
RSPAGPHGLGPLLCPPGAFLPGLKVAQSGAKKSRRPPGKAGLGPQGTRGRGKKLTLACPG
PLADSSVTLSPVDSLDSPRPFGGPPASPGGFPLEGPYAAATATAVSLAQLGGAGRAGLGR
QPPGGCVLSLGLLNPVAVPLDWARLPPPAPPGPSFLLPLAPGPQLLNPGNPVSPQERPPP
YLAAPGHGEEFPAVAAAHGSPPKARFLRVPSEHPYLTPSPESPEHWASPSPPSLSDWSDS
TPSPATATGASATAAGSLSAQPLPLSVPGALAQAQTQLGPQPEVTTKRQVLA
Download sequence
Identical sequences E1BPT8
XP_003586294.1.76553 XP_015319470.1.59421 ENSBTAP00000053357 ENSBTAP00000053357

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]