SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053437 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053437
Domain Number 1 Region: 25-153
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.83e-35
Family Calponin-homology domain, CH-domain 0.00081
Further Details:      
 
Domain Number 2 Region: 1944-2081
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000878
Family Extended AAA-ATPase domain 0.061
Further Details:      
 
Domain Number 3 Region: 1973-2020,2091-2178
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000131
Family RecA protein-like (ATPase-domain) 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053437   Gene: ENSBTAG00000009852   Transcript: ENSBTAT00000061560
Sequence length 2309
Comment pep:known_by_projection chromosome:UMD3.1:5:7393738:7675749:1 gene:ENSBTAG00000009852 transcript:ENSBTAT00000061560 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELKAQRHEEDRVNRTGLETGCETEKTIYTDWANHYLAKSGHKRLIKDLQQDIADGVLLA
EIIQIIANEKVEDINGCPRSQSQMIENVDVCLSFLAARGVNVQGLSAEEIRNGNLKAILG
LFFSLSRYKQQQHHQQQYYQSLVELQQRVTHASPQAEASQAKTQQDMQSSLAARYATQSN
HSGIATSQKKPTRLPGPSRVPAAGNSSKVQGASNLNRRSQSFNSIDKNKPPNYANGNEKD
SSKGPQPSSGVNGNMQPPGTAGQPPASAIPSPSTSKPWRSKSMNAKHSATSTMLTVKQGS
PTTSPTPSADRLKPPASEGVKTAPSGQKSMLEKFKLVNARTALRPPQSASSGPSDGVKED
DAFSESGEMEGLNSGLNSGGSTNSSPKVSPKLAPPKAGSKNLSNKKSLLQPKEKEEKNRD
KSKVCTEKLVKDEKDQMMETAPKKTSKIASLIPKGSKTTAAKKESLIPSSSGIPKPGSKV
PTAKQTVSPGNSASKESEKFRTTKGSPSQSFPKPITTEKASTSSCPAPLEGRETSHASLA
GSSVGLVVQGSGQSMGNGAVQLPQQQQHSHPNTATVAPFIYRAHPENEGTSLPSADSCTS
PTKMDLSYSKTAKQCLEEISGEDPETRRMRTVKNIADLRQNLEETMSSLRGTQISHSTLE
TTFDSTVTTEVNGRTIPNLTGRPTPMTWRLGQACPRLQAGDAPSLGAGYPRSGTGRFIHT
DPSRFMYTTPLRRAAVSRLGNMSQIDMSEKASSDLDMSAEVDVGGYMSDGDILGKSLRTD
DINSGYMTDGGLNLYTRSLHRAPDTTASRDVIQRGLHDVAVDADSWDDSSSVSSGLSDTL
DNISTDDLNTTSSVSSYSNITVPSRKNTQLKTDSEKRSATDEPWESTEELKKPEEDFDSH
GDGGGKWKGVSSGLPEDPEKTGQKASLAVSQTGSWRRGMSAQGGAPSRQKTGTSALKTPG
KTDDAKASEKGKSPLKGSSLQRSPSDAGKSSGDEGKKPPSGIGRSTATGSFGFKKPSGVG
SSAMITSSGATITSGSATLGKIPKSAAIGGKSNAGRKTSLDGSQNQDDVGLHVSTKTSLQ
YRSLPRPSKSSTSGIPGRGGHRSSTSSIDSNVSSKSAGATTSKLREPTKIGSGRSSPVTV
NQTDKEKEKVAVSDSESVSLSGSPKSSPTSASACGTQGLRQPGSKYPDIASPTFRRLFGA
KAGGKPASAPNTEGVKSSSVMSSPSTTLARQGSLESPSSGTGSLGSAGGLSGSSSPLFNK
PSDLTADVISLSHSLASSPASVHSFTSGGLVWAANLSSSSAGSKDTPSYQSMTSLHTSSE
SIDLPLSHHGSLSGLTTGTHEVQSLLMRTGSVRSTLSESMQLDRNTLPKKGLRYTPSSRQ
ANQEEGKEWLRSHSTGGLQDTGNQSPLVSPSAMSSSATGKYHFSNLVSPTNLSQFNLPGP
SMMRSNSIPAQDSSFDLYDDSQLCGSATSLEERPRAISHSGSFRDSMEEVHGSSLSLVSS
TSSLYSTAEEKAHSEQIHKLRRELVASQEKVATLTSQLSANAHLVAAFEKSLGNMTGRLQ
SLTMTAEQKESELIELRETIEMLKAQNSAAQAAIQGALNGPDHPPKDLRIRRQHSSESVS
SINSATSHSSIGSGNDADSKKKKKKNWVNSRGSELRSSFKQAFGKKKSTKPPSSHSDIEE
LTDSSLPASPKLPHNGGDCGSASMKPSQSASAICECTEAEAEIILQLKSELREKELKLTD
IRLEALSSAHHLDQIREAMNRMQNEIEILKAENDRLKAETGNVGKPARPPSESASSTSSS
SSRQSLGLSLNNLNIAESVTSDILLDDPGDATGHKDGRSVKIIVSISKGYGRAKDQKSQA
YLIGSIGVSGKTKWDVLDGVIRRLFKEYVFRIDTSASLGLSSDCIASYCIGDVTRSHGPE
VPELLPCGYLVGDNNVITVNLKGVEENSLDSFVFDTLIPKPITQRYFNLLMEHHRIILSG
PSGTGKTYLAHKLAEYVTTKSGRKKTEDAIATFNVDHKSSKELQQYLANLAEQCSADNNG
AELPVVIILDNLHHVGSLSDIFNGFLNCKYNKCPYIIGTMNQGVSSSPNLELHHNFRWVL
CANHTEPVKGFLGRYLRRKLIEMEIERNIRNNDLVKIIDWIPKTWHHLNSFLETHSSSDV
TIGPRLFLPCPMDVEGSRVWFMDLWNYSLVPYILEAVREGLQMYGKRAPWEDPSKWVLDT
YPWSSASLPQEGPALLQLRPEDVGYEGCISTKEATTSKHIPQADTEGDPLMNMLMKLQEA
ANYSGTQSCDSDSTSHHEDILDSSLESTL
Download sequence
Identical sequences E1BP55
ENSBTAP00000053437 ENSBTAP00000053437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]