SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053528 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053528
Domain Number 1 Region: 202-545,624-648
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.17e-83
Family Myotubularin-like phosphatases 0.0000476
Further Details:      
 
Domain Number 2 Region: 43-186
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000787
Family TFIIH domain 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053528   Gene: ENSBTAG00000012278   Transcript: ENSBTAT00000060955
Sequence length 747
Comment pep:known_by_projection chromosome:UMD3.1:20:41377205:41443084:1 gene:ENSBTAG00000012278 transcript:ENSBTAT00000060955 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGKGVVGGGGGTKAPKPSFVSYVRPEEIHTNEKEATEKEVTLHLLPGEQLLCEANTVLK
CVQEDSCQRGIYGRLVCTDFKIAFLGDDESALDNDETQFKNKVIGENDITLHCVDQIYGV
FDEKKKTLFGQLKKYPEKLVIHCKDLRVFHFCLRYTKEEEVKRIVSGIIHHTQAPKLLKR
LFLFSYATAARNSPATDPKKHAVMFDTLQDWCRELERTKGNMKYKAVSVNEGYKVCERLP
AYFVVPAPLLEEDIEFFQGRGIPIWCWSCHNGCALLKMSALPKEQDDSMSQIQKNFSDRI
YRTVHRPPYETAKTEDLSSNFLSLQEIQMAYSKFKQLFLIDNSTEFWDTDIKWFSLLESS
SWLDIIRRCLKKAVEIIECLEAQNMNVLLLEDNASDLCCLVSSLAQVMMDPHCRTVFGFQ
SLVQKEWVMGGHCFLDRCNHLRQSDKEEVPVFLLFLDCVWQLVHQHPPAFEFTETYLTVL
SDSLYIPIFSTFFFNSPHQKDMNVGKESQDSQSRPLNLLTVWDWSVQFEPKAQTLLTNPL
YVEKPKLEKVQRKGTHFKHQRQLSLPLTQSKSSPKRGFFREETDHLIKNLLGKRISKLIN
SSEELQDGFREFYDGWHSRPPSYQGLLLPHLEGPEIKVWAQRYLRWIPEAQILGGGGVAT
MSKLLEMMEEVQRLQEKIEARHHSQEALQAEAASPPRTSGRLSSLFPFALLQRHSSKPVL
PTSGWKALGDEDDLAKREDEFVDLGDV
Download sequence
Identical sequences E1BNH5
ENSBTAP00000053528 ENSBTAP00000053528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]