SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053563 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053563
Domain Number 1 Region: 549-817
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.45e-83
Family Protein kinases, catalytic subunit 0.000000365
Further Details:      
 
Domain Number 2 Region: 1-280
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 6.02e-60
Family FCH domain 0.00082
Further Details:      
 
Domain Number 3 Region: 449-580
Classification Level Classification E-value
Superfamily SH2 domain 1.62e-31
Family SH2 domain 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053563   Gene: ENSBTAG00000003051   Transcript: ENSBTAT00000060973
Sequence length 822
Comment pep:known_by_projection chromosome:UMD3.1:7:110465382:110864228:1 gene:ENSBTAG00000003051 transcript:ENSBTAT00000060973 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFGSDLKNSHEAVLKLQDWELRLLETVKKFMALRIKSDKEYASTLQNLCNQVDKESTIQ
MNYVSNVSKSWLLMIQQTEQLSRIMKTHAEDLNSGPLHRLTMMIKDKQQVKKSYIGVHQQ
IEAEMIKVTKTELEKLKTSYRQLIKEMNSAKEKYKEAVAKGKETEKAKERYDKATMKLHM
LHNQYVLALKGAQLHQNQYYDTTLPLLLDSLQKMQEEMIKALKGIFDEYSQITSLVTEEI
VNVHKEIQMSVEQIDPSTEYNNFIDVHRTTAAKEQEIEFDTSLLEENENLQANEIMWNNL
TAESLQVMLRTLAEELMQTQQMLVNKEEAVLELEKRIEEAAKTCEKKSDIVLLLSQKQTL
EELKQSVQQLRCTEAKFTAQKELLEQKVQENDGKEPPPVVNYEEDARSVTSMERKERLSR
FESIRHSIAGIIRSPKSALGSSKFCDTIPVLEKPLAEQDWYHGAIPRIEAQDLLKQQGDF
LVRESHGKPGEYVLSVFSDGQRRHFIIQYVDNMYRFEGTGFSNIPQLIDHHYTTKQVITK
KSGVILLNPIPKDKKWILNHEDVTLGELLGKGNFGEVFKGVLKDKTAVAVKTCKEDLPQE
LKIKFLQEAKILKQYDHPNIVKLIGVCTQRQPIYIIMELVPGGDFLTFLRKRKDDIKLKQ
LVKFSLDVASGMAYLESKNCIHRDLAARNCLVGENNVLKISDFGMSRQEDGGVYSSSGLK
QIPIKWTAPEALNYGRYSSESDVWSFGILLWETFSLGVCPYPGMTNQQAREQVERGYRMS
APQHCPEEIFKIMMKCWDYKPENRPKFSELQKELAVIKKKIT
Download sequence
Identical sequences E1BNE0
9913.ENSBTAP00000053563 ENSBTAP00000053563 ENSBTAP00000053563

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]