SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053595 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053595
Domain Number 1 Region: 163-434
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.06e-83
Family Protein kinases, catalytic subunit 0.000000179
Further Details:      
 
Domain Number 2 Region: 70-206
Classification Level Classification E-value
Superfamily SH2 domain 2.63e-34
Family SH2 domain 0.0000118
Further Details:      
 
Domain Number 3 Region: 6-93
Classification Level Classification E-value
Superfamily SH3-domain 4.27e-18
Family SH3-domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053595   Gene: ENSBTAG00000044091   Transcript: ENSBTAT00000061122
Sequence length 446
Comment pep:known chromosome:UMD3.1:13:54599897:54606206:1 gene:ENSBTAG00000044091 transcript:ENSBTAT00000061122 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GQVPLGPRYMGLWDFEARTAEELSFQAGDLFYVARKEEEWWWAVRLDGAGRALAEGYVPY
NYLAEKETVESEPWFFGRISRSEALHRLQAMGNEQGSFLIRISEKPGADYVLSVRDQQTV
RHYKIWWRAGRLHLNEAVSFPGLSELVDHHKVQSLSHGLRLTSPCRKHEPEPLPHCDDWE
RPREEFTLCRKLGSGYFGEVFEGLWKDKVRVAIKVIARADLLHQHTFQSEIQAMKKLRHK
HILALYAVASAGDPVYIVTELMPKGSLLELLRDSDEKALPVSELMDIAAQVAEGMCYLES
QNYIHRDLAARNILVGENNICKVGDFGLARLIKEDIYLSYDHNIPYKWTAPEALSRGHYS
IKSDIWSFGVLLHEIFSRGQMPYPGMSNHEAFLRVESGYRMPRPPECPPTTHKLMLSCWH
KDPEQRPYFKGLWEKLSSLTRYENPL
Download sequence
Identical sequences E1BNA8
ENSBTAP00000053595 ENSBTAP00000053595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]