SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053657 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053657
Domain Number 1 Region: 230-349
Classification Level Classification E-value
Superfamily SH2 domain 2.29e-29
Family SH2 domain 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053657   Gene: ENSBTAG00000039696   Transcript: ENSBTAT00000061173
Sequence length 354
Comment pep:known chromosome:UMD3.1:7:21002693:21010652:-1 gene:ENSBTAG00000039696 transcript:ENSBTAT00000061173 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKWLRDYLSFGGRRPPPQPPTPDYTESDILRAYREQKDLDFEDPYEDADSRLEPDSSGG
PGDSKGPGDAKYDSPKHRLIKVEAVDIARAKVLLGSPGEEGTSTSSPPLSTLPSKVDTEY
SDPFDAQPHPPPPDDGYMEPYDAQRVMSELPCRRVQLYDTPYEEQDQELGDGPPSGQKPR
QSRLPQEDERPADEYDQPWEWKKDHISKAFAVQFDSPDWERTSGSAKELRRPPPRSPQPA
ERVDPTLPLEKQPWFHGLLSRADAENLLSLCKEGSYLVRLSESSPQDCSLSLRSSQGFLH
LKFARTRENQFVLGQHSGPFPSVPELVLHYSSRPLPVQGAEHLALLYPVVSQTP
Download sequence
Identical sequences E1BE26
ENSBTAP00000053657 ENSBTAP00000053657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]