SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053765 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053765
Domain Number 1 Region: 441-742
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.35e-74
Family Protein kinases, catalytic subunit 0.000000378
Further Details:      
 
Domain Number 2 Region: 277-399
Classification Level Classification E-value
Superfamily Kringle-like 3.38e-35
Family Kringle modules 0.00025
Further Details:      
 
Domain Number 3 Region: 65-153
Classification Level Classification E-value
Superfamily Immunoglobulin 9.39e-22
Family I set domains 0.023
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000053765
Domain Number - Region: 171-258
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.0418
Family Frizzled cysteine-rich domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053765   Gene: ENSBTAG00000005092   Transcript: ENSBTAT00000061589
Sequence length 940
Comment pep:known chromosome:UMD3.1:8:87340388:87578642:1 gene:ENSBTAG00000005092 transcript:ENSBTAT00000061589 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARGSALRWLCVPAVWAVAALLLCVSRASGQAEVPDSSDPLGQLDGHDSPVPTLKGYFLN
FLEPVNNITIVQGQTAILHCKVAGNPPPSVRWLKNDAPVVQEPRRVIIRKTEYGSRLRIQ
DLDTTDTGYYQCVATNGVKTITATGVLFVRLGPTHSPNHNFQDDYHEDGFCQPYRGIACA
RFIGNRTIYVDSLQMQGEIENRITAAFTMIGTSTHLSDQCSQFAIPSFCHFVFPLCDARS
RAPKPRELCRDECEVLESDLCRQEYTIARSNPLILMRLQLPKCEALPMPESPDAANCMRI
GIPAERLGRYHQCYNGSGTDYRGTASTTKSGHQCQPWALQHPHSHHLTSTDFPELGGGHA
YCRNPGGQMEGPWCFTQNKNVRMELCDVPSCSPQDSSRMGILYILVPSIAIPLVIACLFF
LVCMCRNKQKASASTPQRRQLMASPSQDVEMPLINQHKQAKLKEISLSTVRFMEELGEGR
FGKVYKGHLFGPAPGEQTQAVAIKTLKDKAEGPLREEFRHEALLRARLQHPNIVCLLGVV
TKDQPLSMIFSYCPHGDLHEFLVMRSPHSDVGSTDDDRTVKSALEPPDFVHVVAQIAAGM
EYLSSHHVVHKDLATRNVLVYDKLTVKISDLGLFREVYSADYYKLTGNALLPIRWMSPEA
IMYGKFSVDSDIWSYGVVLWEVFSYGLQPYCGHSNQDVVEMVRSRQVLPCPDDCPAWVYA
LMIECWHEFPSRRPRFKDIHSRLRAWGNLSTYNSSAQTSGASNATQTSSLSTSPVSNVSN
ARYGGPKQKAQPFPQPQFIPMKGQIRPMVPPPQLYIPVNGYQPVPAYGAYLPNFYPVQIP
MQMAPQQVPAQMVPKPGSHHSGSGSTSTGYVTTAPSNTSVADRAALLSEGTEDAQNVPED
MAQSPVQEAEEEEDGSVPETELLGDNDTLQMSEAEVQLEA
Download sequence
Identical sequences E1BC57
ENSBTAP00000053765 9913.ENSBTAP00000053765 NP_001098934.2.59421 NP_001098934.2.76553 ENSBTAP00000053765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]