SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053792 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053792
Domain Number 1 Region: 2125-2199,2226-2275,2341-2366,2404-2602
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 1.01e-85
Family Hect, E3 ligase catalytic domain 0.0000473
Further Details:      
 
Domain Number 2 Region: 363-485
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.87e-25
Family Ankyrin repeat 0.00076
Further Details:      
 
Domain Number 3 Region: 1268-1336
Classification Level Classification E-value
Superfamily Mib/herc2 domain-like 2.22e-22
Family Mib/herc2 domain 0.0000087
Further Details:      
 
Domain Number 4 Region: 11-215,512-638,891-943
Classification Level Classification E-value
Superfamily ARM repeat 3.15e-20
Family Armadillo repeat 0.022
Further Details:      
 
Domain Number 5 Region: 1088-1240
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000000000247
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053792   Gene: ENSBTAG00000032477   Transcript: ENSBTAT00000061351
Sequence length 2610
Comment pep:known_by_projection chromosome:UMD3.1:21:42121456:42196305:-1 gene:ENSBTAG00000032477 transcript:ENSBTAT00000061351 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADVDPDTLLEWLQMGQGDERDMQLIALEQLCMLLLMSDNVDRCFETCPPRTFLPALCKI
FLDESAPDNVLEVTARAITYYLDVSAECTRRIVGVDGAIKALCNRLVVVELNNRTSRDLA
EQCVKVLELICTRESGAVFEAGGLNCVLTFIRDSGHLVHKDTLHSAMAVVSRLCGKMEPQ
DSSLEICVESLSSLLKHEDHQVSDGALRCFASLADRFTRRGVDPAPLAKHGLTEELLSRM
AAAGGTISGPSSACKPSRSTTGAPSTAADSKLSNQVSTIVSLLSTLCRGSPVVTHDLLRS
ELPDSIESALQGDERCVLDTMRLVDLLLVLLFEGRKALPKSSAGSTGRIPGLRRLDSSGE
RSHRQLIDCIRSKDTDALIDAIDTGAFEVNFMDDVGQTLLNWASAFGTQEMVEFLCERGA
DVNRGQRSSSLHYAACFGRPQVAKTLLRHGANPDLRDEDGKTPLDKARERGHSEVVAILQ
SPGDWMCPVNKGDDKKKKDTNKDEEECNEPKGDPEMAPIYLKRLLPVFAQTFQQTMLPSI
RKASLALIRKMIHFCSEALLKEVCDSDVGHNLPTVLVEITATVLDQEDDDDGHLLALQII
RDLVDKGGDIFLDQLARLGVISKVSTLAGPSSDDENEEESKPEKEDEPQEDAKELQQGKP
YHWRDWSIIRGRDCLYIWSDAAALELSNGSNGWFRFILDGKLATMYSSGSPEGGSDSSES
RSEFLEKLQRARGQVKPSTSSQPILSAPGPTKLTVGNWSLTCLKEGEIAIHNSDGQQATV
LKEDLPGFVFESNRGTRHSFTAETSLGSEFVTGWTGKRGRKLKSKLEKTKQKVRTMARDL
YDDHFKAVESMPRGVVVTLRNIATQLESSWELHTNRQCIESENTWRDLMKTALENLIVLL
KDENTISPYEMCSSGLVQALLTVLNNSMDLDMKQDCSQLVERINVFKTAFSENEDDESRP
AVALIRKLIAVLESIERLPLHLYDTPGSTYNLQILTRRLRFRLERAPGETALIDRTGRML
KMEPLATVESLEQYLLKMVAKQWYDFDRSSFVFVRKLREGQNFIFRHQHDFDENGIIYWI
GTNAKTAYEWVNPAAYGLVVVTSSEGRNLPYGRLEDILSRDNSALNCHSNDDKNAWFAID
LGLWVIPSAYTLRHARGYGRSALRNWVFQVSKDGQNWTSLYTHVDDCSLNEPGSTATWPL
DPPKDEKQGWRHVRIKQMGKNASGQTHYLSLSGFELYGTVNGVCEDQLGKAAKEAEANLR
RQRRLVRSQVLKYMVPGARVIRGLDWKWRDQDGSPQGEGTVTGELHNGWIDVTWDAGGSN
SYRMGAEGKFDLKLAPGYDPDTVASPKPVSSTVSGTTQSWSSLVKNNCPDKTSAAAGSSS
RKGSSSSVCSVASSSDISLGSTKTERRSEIVMEHSIVSGADVHEPIVVLSSAENVPQTEV
GSSSSASTSTLTAETGSENAERKLGPDSSARTPGESSAISMGIVSVSSPDVSSVSELTNK
EAASQRPLSSSASNRLSVSSLLAAGAPMSSSASVPNLSSRETSSLESFVRRVANIARTNA
TNNMNLSRSSSDNNTNTLGRNVMSTATSPLMGAQSFPNLTTPGTTSTVTMSTSSVTGSSN
VATATTVLSVGQSLSNTLTTSLTSTSSESDTGQEAEYSLYDFLDSCRASTLLAELDDDED
LPEPDEEDDENEDDNQEDQEYEEVMILRRPSLQRRAGSRSDVTHHAVTSQLPQVPAGAGS
RPIGEQEEEEYETKGGRRRTWDDDYVLKRQFSALVPAFDPRPGRTNVQQTTDLEIPPPGT
PHSELLEEVECTPSPRLALTLKVTGLGTTREVELPLTNFRSTIFYYVQKLLQLSCNGNVK
SDKLRRIWEPTYTIMYREMKDSDKEKENGKMGCWSIEHVEQYLGTDELPKNDLITYLQKN
ADAAFLRHWKLTGTNKSIRKNRNCSQLIAAYKDFCEHGTKSGLNQGAISTLQSSDILNLT
KEQPQAKAGNGQNSCGVEDVLQLLRILYIVASDPYSRISQEEGDEQPQFTFPPDEFTSKK
ITTKILQQIEEPLALASGALPDWCEQLTSKCPFLIPFETRQLYFTCTAFGASRAIVWLQN
RREATVERTRTTSSVRRDDPGEFRVGRLKHERVKVPRGESLMEWAENVMQIHADRKSVLE
VEFLGEEGTGLGPTLEFYALVAAEFQRTDLGAWLCDDNFPDDESRHVDLGGGLKPPGYYV
QRSCGLFTAPFPQDSDELERITKLFHFLGIFLAKCIQDNRLVDLPISKPFFKLMCMGDIK
SNMSKLIYESRGDRDLHCTESQSEASTEEGHDSLSVGSFEEDSKSEFILDPPKPKPPAWF
NGILTWEDFELVNPHRARFLKEIKDLAIKRRQILSNKGLSEDEKNTKLQELVLKNPSGSG
PPLSIEDLGLNFQFCPSSRIYGFTAVDLKPSGEDEMITMDNAEEYVDLMFDFCMHTGIQK
QMEAFRDGFNKVFPMEKLSSFSHEEVQMILCGNQSPSWAAEDIINYTEPKLGYTRDSPGF
LRFVRVLCGMSSDERKAFLQFTTGCSTLPPGGLANLHPRLTVVRKVDATDASYPSVNTCV
HYLKLPEYSSEEIMRERLLAATMEKGFHLN
Download sequence
Identical sequences E1BLD1
ENSBTAP00000053792 XP_002696742.1.76553 XP_005222128.1.76553 XP_015324025.1.59421 XP_877459.5.59421 ENSBTAP00000053792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]