SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053903 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSBTAP00000053903
Domain Number - Region: 108-256
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000289
Family FAD-linked reductases, N-terminal domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053903   Gene: ENSBTAG00000018321   Transcript: ENSBTAT00000063985
Sequence length 287
Comment pep:known_by_projection chromosome:UMD3.1:26:25835311:25855778:-1 gene:ENSBTAG00000018321 transcript:ENSBTAT00000063985 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLFSRWQMLLGRRLSPSDLTPRHRGPRALEVKALARASEAEKRLLLRLLAPFPRLLRTR
TRPEQASRPPALSLGGDGRLQRRHRWIIHRPLRAGPRTSERPSATFPRGGVVEVGAHWIH
GPSQGNPVFQLAAKYGLLGEKALSEENQLIETGGHVGLPSVSYASSGVSVSLELVAEMAS
LFYSLIDQTREFLLAAETTPPSVGEYLKEKIRQHMAGWTEDEETKKLKLAILKNLFNVEC
CVSGTHSMDLVALAPFGEYTVLPGLDCTFPEATKDSQTASWPPCPRT
Download sequence
Identical sequences G3MWK2
ENSBTAP00000053903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]