SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053922 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSBTAP00000053922
Domain Number - Region: 135-216
Classification Level Classification E-value
Superfamily Caspase-like 0.0889
Family Caspase catalytic domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053922   Gene: ENSBTAG00000046979   Transcript: ENSBTAT00000065983
Sequence length 433
Comment pep:known chromosome:UMD3.1:21:57965316:58004541:-1 gene:ENSBTAG00000046979 transcript:ENSBTAT00000065983 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIWEVTVLLSLVLGTGAVPLEDPEDGGKHWVVIVAGSNGWYNYRHQADACHAYQIVHRNG
IPDEQIIVMMYDDIANSEDNPTPGIVINRPNGSDVYQGVLKDYTGEDVTPKNFLAVLRGD
AEAVKGVGSGKVLKSGPRDHVFVYFTDHGATGILVFPNEDLHVKDLNETIRYMYEHKMYQ
KMVFYIEACESGSMMNHLPPDINVYATTAANPRESSYACYYDEQRSTFLGDWYSVNWMED
SDVEDLTKETLHKQYQLVKSHTNTSHVMQYGNKSISAMKLMQFQGLKHQASSPISLPAVS
RLDLTPSPEVPLSIMKRKLMSTNDLQESRRLVQKIDRHLEARNIIEKSVRKIVTLVSGSA
AEVDRLLSQRAPLTEHACYQTAVSHFRSHCFNWHNPTYEYALRHLYVLVNLCENPYPIDR
IKLSMNKVCHGYY
Download sequence
Identical sequences A0A140T8D4
ENSBTAP00000053922 ENSBTAP00000053922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]