SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053944 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053944
Domain Number 1 Region: 19-247
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.4e-63
Family Eukaryotic proteases 0.000000178
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053944   Gene: ENSBTAG00000046188   Transcript: ENSBTAT00000064480
Sequence length 286
Comment pep:known chromosome:UMD3.1:7:44988172:44991299:1 gene:ENSBTAG00000046188 transcript:ENSBTAT00000064480 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTQSCRRFSPALAPILLALLLGGPALASEIVGGRAARPHAWPFIASLQRRGGHFCGATLI
ARNFVLSAAHCLNGLNFRSVRVVLGAHNLRRQERTRQMFRVRRVFENGFDPLSLQNDVVV
LQLNRMATLNANVQVARLPAQDQGVGEGVRCVAMGWGRLGTNRPPPQILQQLNVTVVTGL
CRPTNVCTLVPRRRAGICFGDSGGPLVCNGLVHGIDSFIRGGCGSGVFPDSFASVAKFAN
WINSIIRRYSDDDGPSLHPRDPTEKDPSEALSRKQPARSWGPRPAS
Download sequence
Identical sequences G3MWP1
ENSBTAP00000055933 ENSBTAP00000053944

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]