SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053996 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053996
Domain Number 1 Region: 122-502
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.75e-47
Family FAD/NAD-linked reductases, N-terminal and central domains 0.000000525
Further Details:      
 
Domain Number 2 Region: 479-601
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 7.04e-30
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000333
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053996   Gene: ENSBTAG00000013912   Transcript: ENSBTAT00000064242
Sequence length 609
Comment pep:known chromosome:UMD3.1:5:68261572:68302678:1 gene:ENSBTAG00000013912 transcript:ENSBTAT00000064242 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVDEYWLCLPAFHVRPFVQTVRMMQSCPCCCWFPGVLPLVPEPSCIPAALPAGSRAAPP
PPLHTAPSSSSQASFSTDPKLCLLPPTSDGRQEENVQSGLASQENRLQNPVKMNGSKDLP
EPYDYDLIIIGGGSGGLAAAKEAAKYDKKVMVLDFVTPTPLGTRWGLGGTCVNVGCIPKK
LMHQAALLGQALRDSRNYGWNVEETVKHDWERMTEAVQNHIGSLNWGYRVALREKKVTYE
NAYGEFVGPHRIKATNNKGKEKIYSAERFLIATGERPRYLGIPGDKEYCISSDDLFSLPY
CPGKTLVVGASYVALECAGFLAGIGLDVTVMVRSILLRGFDQDMANKIGEHMQEHGIKFI
RQFVPIKVEQIEAGTPGRLRVIAKSTDSDQTIEGEYNTVLLAIGRDACTRKIGLENVGVK
INEKTGKIPVTEEEQTNVPYIYAIGDILEGKLELTPVAIQAGRLLAQRLYGGSTVKCDYE
NVPTTVFTPLEYGSCGLSEEKAVEKFGEENVESCHSFEWPLEWTIPSRDNNKCYAKVVCN
IKDNERVVGFHVLGPNAGEVTQGFAAALKCGLTKDQLDSTIGIHPVCAEVFTTLSVTKRS
GGNILQTGC
Download sequence
Identical sequences G3MWU1
ENSBTAP00000053996 ENSBTAP00000053996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]