SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000054070 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000054070
Domain Number 1 Region: 3873-4243
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 3.84e-101
Family Regulator of chromosome condensation RCC1 0.0016
Further Details:      
 
Domain Number 2 Region: 4380-4711
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 1.57e-88
Family Hect, E3 ligase catalytic domain 0.0000392
Further Details:      
 
Domain Number 3 Region: 333-689
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.92e-87
Family Regulator of chromosome condensation RCC1 0.0073
Further Details:      
 
Domain Number 4 Region: 2881-3172
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 4.53e-61
Family Regulator of chromosome condensation RCC1 0.0016
Further Details:      
 
Domain Number 5 Region: 2650-2832
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.19e-32
Family APC10-like 0.0064
Further Details:      
 
Domain Number 6 Region: 2472-2547
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 8.12e-29
Family CPH domain 0.00079
Further Details:      
 
Domain Number 7 Region: 3123-3246
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 2.88e-28
Family Regulator of chromosome condensation RCC1 0.046
Further Details:      
 
Domain Number 8 Region: 1779-1845
Classification Level Classification E-value
Superfamily Mib/herc2 domain-like 2.48e-21
Family Mib/herc2 domain 0.00013
Further Details:      
 
Domain Number 9 Region: 1120-1204
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 0.00000000000011
Family Cytochrome b5 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000054070   Gene: ENSBTAG00000013916   Transcript: ENSBTAT00000063010
Sequence length 4757
Comment pep:known_by_projection chromosome:UMD3.1:2:646582:837885:-1 gene:ENSBTAG00000013916 transcript:ENSBTAT00000063010 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLKTFLTLYHVYRRTDFLDVNELKECLSVLVKEQQALAIQSATTTLSALRLKQRLIVLER
YFIALNRTVFQENVKVKWKSSNISLPPVDKKSSRPAGKGVEGLARVGSRAALSFAFAFLR
RAWRSGEDADLCSELLQESLDALRALPEASLFDESTVSSVWLEVVERATRFLRSVVTGDV
HGTPGTKGPGSIPLQDQHLALAILLELAVQRGALSQMLSAVLLLLHLWDSGTRETDNERS
AQGTSAPLLPLLRRFRSIVCSKDGPCAEVDTHLLSGPLSPNESFLRYLTLPQDNELAIDL
RQTAVVVMAHLDRLATPCMPPLCSSPTSHKGSLQEVIGWGLIGWKYYANVIGPIQCEGLA
NLGVTQIACAEKRFLILSRNGRVYTQAYNSDTLAPQLVQGLASRNIVKIAAHSDGHHYLA
LAATGEVYSWGCGDGGRLGHGDTVPLEEPKVISAFSGKQAGKHVVHIACGSTYSAAITAE
GELYTWGRGNYGRLGHGSSEDEAIPMLVAGLKGLKVIDVACGSGDAQTLAVTENGQVWSW
GDGDYGKLGRGGSDGCKTPKLIEKLQDLDVVKVRCGSQFSVALTKDGQVYSWGKGDNQRL
GHGTEEHVRYPKLLEGLQGKKVIDVAAGSTHCLALTEDSEVHSWGSNDQCQHFDTLRVTK
PEPSALPGLDTKHIVGIACGPAQSFAWSSCSEWSIGLRVPFVVDICSMTFEQLDLLLRQV
SEGMDGTADWPPPQEKECMTVATLNLLRLQLHAAISHQVDPEFLGLGLGSVLLNSLKQTV
VALASSAGVLSTVQAAAQAVLQSGWSVLLPTAEERARALSALLPCAVSGNEVNISPGRRF
MIDLLVGSLMADGGLESALNAAITAEIQDIEAKKEAQKEKEIDEQEANASTFHRSRTPLD
KDLINTGIYESSGKQCLPLVQLIQQLLRNIASQTVARLKDVARRISSCLDFEQHSRERSA
SLDLLLRFQRLLISKLYPGESVGQTSEISSPELMGVGSLLKKYTALLCTHIGDILPVAAS
IASTSWRHFAEVACIVEGDFTGILLPELVVSIVLLLSKNAGLMQEAGAVPLLGGLLEHLD
RFNHLAPGKERDDLEELAWPGIMVYTESFFTGQNCRNNEEVTLIRKADLENHNKDGGFWT
VIDGKVYDIKDFQTQSLTGNSILAQFVGEDPVVALEAALQFEDTRESMHAFCVGQYLEPD
QEVVTIPDLGSLSSPLIDTERNLGLLLGLHASYLAMSTPLSPVEVECAKWLQSSIFSGGL
QTSQIHYSYNEEKDEDHCSSPGGTPASKSRLCSHRQALGDHAQAFLQAIADNNIQDHNVK
DFLCQIERYCRQCHLTTPITFPPEHPVEEVGRLLLCCLLKHEDLGHVALSLVHAGTLGIE
QVKHRTLPKSVVDVCRVVYQAKCSLIKTHQEQGRSYKEVCAPVIERLRFLFNELRPAVCN
DLSIMSKFKLLSSLPRWKRIAQKIIRERRKKRDIVPKKPESTEEEEKIGNGESDLEEACI
LPHSPINVDKRPITIKSPKDKWQPLLSTVTGVHRYKWLKQNVQGLYPQSALLSTIAEFAL
KEEPVDVEKMRKCLLKQLERAEVRLEGIDTILKLAAKNFLLPSVQYAMFCGWQRLIPEGI
DIGEPLTDCLKDVDLIPPFNRMLLEVTFGKLYTWAVQNIRNVLIDANTKFKELGIQPVPL
QTITNENPSGPSLGTTPQARFLLVMLSMLTLQHGAHNLSLLLNSGTLALTQTALRLIGPS
CDNVEEDMNASARGASATVLEETRKETAPVQLPVSGPELAAMMKIGTRVMRGVDWKWGDQ
DGPPPGLGRVIGELGEDGWIRVQWDTGSTNSYRMGKEGKYDLKLAELPVSTQPSAEDSDT
EDDSEAEQIERNIHPTAMMLTSTVNLLQTLCLSAGVHAEVMQSEATKTLCGLLRMLVESG
TTDKTSSPSRLVCREQHRSWCTLGFVRSIALTPHMCAALSSPPWISLLVKVVEGHSPFTA
ASLQRQILAVHLLQAVLPSWDKTERARDMECLVEKLFGFLGSLLTTCSSDVPFLRESTLR
RRRARPQASLTATHSSTLAEEVVALLRTLHSLGQWNGLINKYINSQLHSVTRSCAGKPAE
GALLDDYFPDCENPEVGSLMAVLAVIGGIDGRLRLGGQVMHDDFGEGTVTRITPKGKITV
QFCDLRTCRVCPLNQLKPLPAVAFSVTNLPFTEPMLSVWAQLVNLAGSKLEKHKIKKSPK
QGFAGQVDLDLLRCQQLKLYILKAGRALLSHQDQLRQILSQPAVQEAAAAHTDSDDGAAV
SPDLVDMSPEGPQPPMILLQQLLASATQPSPVKAIFDKQELEAAALAVCQCLAVESTHPL
SPVFEDCSSSEATTPVPVQHIRPVRAKKHKQSPGPVLPIVVQLMEMGFPRRNIEFALKSL
TGASGNAAGLPGVEALVGWLLDHADVQVTDLSDADTGSEECSDEEVVEDVDDTAYAMSTG
AVVTESQTYKKRADFLSNDDYAVYVRENIQVGMMVRCCRTYEEVCEGDVGKVIKLDRDGL
HDLNVQCDWQQKGGTYWVRYIHVELIESLGYPPPSSPSHIKIGDKVRVKASVTTPKYKWG
SVTHQSVGVVKAFSANGKDVIVDFPQQSHWTGLLSEMELVPSVHPGVTCDGCQMFPINGS
RFKCRNCDDFDFCEACFKTRKHNTRHTFGRINEPGQSAIFCGRSGKQLKRCHNSQPGMLL
DSWARMVKSLNVSSSVNQASRLIDGSEPCWQSSGSQGKHWIRLEIFPDVLVHRLKMIVDP
ADSSYMPSLVVVSGGNSLNNLIELKTININPTDTTVSLLNDCTEYHRYIEIAIKQCRSSG
IDCKIHGLILLGRIRAEEEDMAAVPFLASDNEEEEDEKGNSGSLIRKKAAGLESAATIRT
KVFVWGLNDKDQLGGLKGSKIKVPSFSETLSALNVVQVAGGSKSLFAVTVEGKVYACGEA
TNGRLGLGISSGTVPIPRQITALSSYVVKKVAVHSGGRHATALTVDGKVFSWGEGDDGKL
GHFSRMNCDKPRLIEALKTKRIRDIACGSSHSAALTSSGELYTWGLGEYGRLGHGDNTTQ
LKPKMVKVLLGHRVIQVACGSRDAQTLALTDEGLVFSWGDGDFGKLGRGGSEGCNIPQNI
ERLNGQGVCQIECGAQFSLALTKSGVVWTWGKGDYFRLGHGSDVHVRKPQVVEGLRGKKI
VHVAVGALHCLAVTDAGQVYAWGDNDHGQQGNGTTTVNRKPTLVQGLEGQKITRVACGSS
HSVAWTTVDVATPSVHEPVLFQTARDPLGASYLGVPSDADSSPASNKINGANNSKPNRPS
LAKILLSLDGNLAKQQALSHILTALQIMYARDTVVGALMPAGMVAPVECPSFSSSAPASD
VSAMASPMNGEECVLAVDIEDRLSPNPWQEKRGEIISSEDAVTPSAVTPSACSASSRPFI
PVTDDPGAASIIAETMTKTKEDVESQNKVSGPELQSLDEFTSLLVVDDTRVLVDLLKLSV
CGRAGDKGRDVLSAVLSGMGTAYPQVADMLLELCVTELEDVATDSQSGRLSSQPVVVESS
HPYTDDTSSSGTVKIPGAEGLRVEFDRQCSTERRHDPLTVMDGVNRIVSVRSGREWSDWS
SELRIPGDELKWKFISDGSVNGWGWRFTVYPIMPAAGPKDLLSDRCVLSCPSMDLVTCLL
DFRLNLASNRSIIPRLAASLAACAQLSALAASHRMWALQRLRKLLTTEFGQSININRLLG
DNDGETRALSFSGSALAALVKGLPEALQRQFEYEDPIVRGGKQLLHSPFFKVLVALACDL
ELDTLPCCAETHKWAWFRRYCMASRVAVALDKRTSLPRLFLDEVAKKIRELMADGENMDV
LHESHSIFRREQDEQLVQWMNRRPDDWTLSAGGSGTIYGWGHNHRGQLGGIEGAKVKVPT
PCEALAALRPVQLIGGEQTLFAVTADGKLYATGYGAGGRLGVGGTESVSTPTLLESIQHV
FIKKVAVNSGGKHCLALSSEGEVYSWGEAEDGKLGHGNRSPCDRPRVIESLRGTEVVDVA
AGGAHSACVTAAGDLYTWGKGRYGRLGHSDSEDQLKPKLVEALQGHRVVDVACGSGDAQT
LCLTDDDTVWSWGDGDYGKLGRGGSDGCKVPMKIDSLTGLGVVKVECGSQFSVALTKSGA
VYTWGKGDYHRLGHGSDDHVRRPRQVQGLQGKKVIAIATGSLHCVCCSEDGEVYTWGDND
EGQLGDGTTNAIQRPRLVAALQGKKVNRVACGSAHTLAWSTSKPASAGKLPVQVPMEYNH
LQEIPIIALRNRLLLLHHISELFCPCIPMFDLEGSLDETGLGPSVGFDTLRGILISQGKE
AAFRKVVQATMVRDRQHGPVVELNRIQVKRSRSKGGLAGPDGTKSVFGQMCAKMTSFSPD
SLLLPHRVWKVKFVGESVDDCGGGYSESIAEICEELQNGLTPLLIVTPNGRDESGANRDC
YLFSPAARAPVHTNMFRFLGVLLGIAIRTGSPLSLNLAEPVWKQLAGMSLTIADLSEVDK
DFIPGLMYIRDNEATSEEFEAMSLPFTVPSASGQDIQLSSKYTHITLDNRAEYVRLAINY
RLHEFDEQVAAVREGMARVVPVPLLSLFTGYELETMVCGSPDIPLHLLKSVATYKGVEPS
APLIQWFWEVMESFSNTERSLFLRFVWGRTRLPRTIADFRGRDFVIQVLDKYNPPDHFLP
ESYTCFFLLKLPRYSCKQVLEEKLKYAIHFCKSIDTDDYARIALTGEPAADDSSDDSENE
DVDSFASDSTQDYLTGH
Download sequence
Identical sequences G3MX12
ENSBTAP00000054070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]