SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000054089 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000054089
Domain Number 1 Region: 515-774
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.21e-79
Family Eukaryotic proteases 0.00024
Further Details:      
 
Domain Number 2 Region: 4-258
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.23e-70
Family Eukaryotic proteases 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000054089   Gene: ENSBTAG00000005365   Transcript: ENSBTAT00000063566
Sequence length 774
Comment pep:known_by_projection chromosome:UMD3.1:5:80508638:80552681:1 gene:ENSBTAG00000005365 transcript:ENSBTAT00000063566 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ESRFFSRISSWRNSTVGGHPWQVSLKLGGHHFCGGSLIQDDLVVTAVHCLIGLNEKQIKS
LTVTAGEYNLFQKDKEEQNIPVSKIIIHPEYNRLGYMSFNIALLYLKLKVKFGTTVQPIC
IPHRGDKFEEGIFCMASGWGKISETSEYSNILQEVEVPIMDDRRCGAMLRGMNLPPLGRD
MLCASFPDGEKDACQKRDSGGPLVCRRDDGVWVLAGITSWAAGCTRVWNPFRNKQRKASP
GIFSKVFVLMDFITQTMTDTLCCIYNQKIVSLEGGFLCVTSHYLILLRNQNSPTKTKYNR
LTWRMKKTKNYTYWLRTRFFFNLSRLVKSTKNKSLLFCFSHSPLLILLRKSENISNFFLR
KWHRERSKELNSEGPRRFAIKGGSICLSQDPELQKTVFPPSSLSFRLQNKCVLFIAMITG
RTCLLVAILFGFHHLEEKSNEYQNVTSNLVKQHLLNIILLIFSFPSCLYSTFMKYFSEKK
DKKKRYNSVVFCRPVPIKPNWLAESPRQELLLLTSCEVSTVDYGVCGIPPFSPQWLSRRI
AGGVEACPHCWPWQVGLRFLGNHQCGGAIINSIWILTAAHCVQSKNNPLFWTIVAGDHDI
TLKESTEQVRRAKHIVMHEDFDSLSYDSDIALIQLSSALEFNSVVRPVCLPHSLEPLFSS
EICVVTGWGSANKDGGLASRLQQIQVPVLEREVCERTYYSAHPGGISEKMICAGFAASGE
KDKCSKGDSGGLLVCKHEKGPFVLYGIVSWGAGCDQPRKPGVFARVSVFLDWIQ
Download sequence
Identical sequences G3MX30
ENSBTAP00000054089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]