SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000054121 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000054121
Domain Number 1 Region: 384-502
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.49e-35
Family Calponin-homology domain, CH-domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000054121   Gene: ENSBTAG00000003100   Transcript: ENSBTAT00000065365
Sequence length 513
Comment pep:known chromosome:UMD3.1:17:72053880:72064312:1 gene:ENSBTAG00000003100 transcript:ENSBTAT00000065365 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGVPGPGSELAAALEERLGRALEELRAVAEAGRAAVTQAAEAAASAMEPVARAAEELRV
ETAALSRRLDALGRQVEVLSLRMGVPLVPDLEPELEPSELLLAAADPEALFQAAEDAGTP
VAHPPAFSTRRRSSAGPAHSASLMEPEPAEPPSAAVEVANGAEQTRVDKAPGSRSPLSAE
ELMAIEDESVLDKMLDQTTDFEERKLIRAALRELRQRKRDQRDKERERRLQEARARPGEG
RGNTTTKTSTRHSQQTADGSAVSTVTKTERLVQSNDGTRTARTTTVESSFVRRSENGGGS
TMMQTKTFSSSSSKKMGSIFDREDEASPRSGSLAALEKRQAEKKKELMKAQSLPKTSASQ
ARKAMIEKLEKEGAAGSPGGPRMAVQRSTSFGVPNANSIKQMLLDWCRAKTRGYEHVDIQ
NFSSSWSDGMAFCALVHNFFPEAFDYGQLSPQNRRQNFEVAFSSAETHADCPQLLDTEDM
VRLREPDWKCVYTYIQEFYRCLVQKGLVKTKKS
Download sequence
Identical sequences A6QP52
ENSBTAP00000054121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]