SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000054125 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000054125
Domain Number 1 Region: 119-167
Classification Level Classification E-value
Superfamily Elafin-like 0.0000000000589
Family Elafin-like 0.00043
Further Details:      
 
Domain Number 2 Region: 27-72
Classification Level Classification E-value
Superfamily Elafin-like 0.00000000314
Family Elafin-like 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000054125   Gene: ENSBTAG00000013928   Transcript: ENSBTAT00000066322
Sequence length 169
Comment pep:novel chromosome:UMD3.1:13:75077194:75084338:1 gene:ENSBTAG00000013928 transcript:ENSBTAT00000066322 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPACRLGPLLAALLLGLLLGLPPVTGSIAVKPGECPELEGDANCTKACVLDEDCDDNLKC
CQAGCATVCQMPNVLSEWLESRSSTHSGLFGELLAIDALLSWGSSVLRAPALLQERTGGN
KPGSCPNVDIAFPQLGLCRDQCQVDSQCPDALKCCVNGCGRVSCVTPVF
Download sequence
Identical sequences G3MX65
ENSBTAP00000054125 ENSBTAP00000054125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]