SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000054149 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000054149
Domain Number 1 Region: 753-1007
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.59e-87
Family Eukaryotic proteases 0.00000000613
Further Details:      
 
Domain Number 2 Region: 333-491
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.06e-36
Family MAM domain 0.006
Further Details:      
 
Domain Number 3 Region: 519-622
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.53e-27
Family Spermadhesin, CUB domain 0.0008
Further Details:      
 
Domain Number 4 Region: 219-324
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.79e-17
Family Spermadhesin, CUB domain 0.0014
Further Details:      
 
Domain Number 5 Region: 64-166
Classification Level Classification E-value
Superfamily SEA domain 2.35e-16
Family SEA domain 0.0099
Further Details:      
 
Domain Number 6 Region: 662-763
Classification Level Classification E-value
Superfamily SRCR-like 0.0000000000000196
Family Scavenger receptor cysteine-rich (SRCR) domain 0.013
Further Details:      
 
Domain Number 7 Region: 630-667
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000144
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 8 Region: 167-209
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000157
Family LDL receptor-like module 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000054149   Gene: ENSBTAG00000000597   Transcript: ENSBTAT00000064206
Sequence length 1008
Comment pep:known chromosome:UMD3.1:1:18058709:18207251:1 gene:ENSBTAG00000000597 transcript:ENSBTAT00000064206 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSKRSVPSRHRSLTTYEVMFAVLFVILVALCAGLIAVSWLSIQGSVKDAAFGKSHEARG
TLKIISGATYNPHLQDKLSVDFKVLAFDIQQMIDDIFQSSNLKNEYKNSRVLQFENGSII
VIFDLLFDQWVSDKNVKEELIQGIEANKSSQLVTFHIDLNSIDITGNVSIECPPDSRLCA
DALKCIAIDLFCDGELNCPDGSDEDNKTCATACDGRFLLTGSSGSFEALHYPKPSNNTSA
VCRWIIRVNQGLSIQLNFDYFNTYYADVLNIYEGMGSSKILRASLWSNNPGIIRIFSNQV
TATFLIQSDESDYIGFKVTYTAFNSKELNNYEKINCNFEDGFCFWIQDLNDDNEWERTQG
STFPPSTGPTFDHTFGNESGFYISTPTGPGGRRERVGLLTLPLDPTPEQACLSFWYYMYG
ENVYKLSINISSDQNMEKTIFQKEGNYGQNWNYGQVTLNETVEFKVSFYGFKNQILSDIA
LDDISLTYGICNVSVYPEPTLVPTPPPELPTDCGGPHDLWEPNTTFTSINFPNSYPNQAF
CIWNLNAQKGKNIQLHFQEFDLENIADVVEIRDGEGDDSLFLAVYTGPGPVNDVFSTTNR
MTVLFITDNMLAKQGFKANFTTGYGLGIPEPCKEDNFQCKDGECIPLVNLCDGFPHCKDG
SDEAHCVRLFNGTTDSSGLVQFRIQSIWHVACAENWTTQISDDVCQLLGLGTGNSSVPTF
STGGGPYVNLNTAPNGSLILTPSQQCLEDSLILLQCNYKSCGKKLVTQEVSPKIVGGSDS
REGAWPWVVALYFDDQQVCGASLVSRDWLVSAAHCVYGRNMEPSKWKAVLGLHMASNLTS
PQIETRLIDQIVINPHYNKRRKNNDIAMMHLEMKVNYTDYIQPICLPEENQVFPPGRICS
IAGWGALIYQGSTADVLQEADVPLLSNEKCQQQMPEYNITENMVCAGYEAGGVDSCQGDS
GGPLMCQENNRWLLAGVTSFGYQCALPNRPGVYARVPRFTEWIQSFLH
Download sequence
Identical sequences ENSBTAP00000054149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]