SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000054167 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000054167
Domain Number 1 Region: 69-246
Classification Level Classification E-value
Superfamily EF-hand 2.53e-48
Family Calmodulin-like 0.000000169
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000054167   Gene: ENSBTAG00000047743   Transcript: ENSBTAT00000065041
Sequence length 250
Comment pep:known chromosome:UMD3.1:6:41709362:43021626:-1 gene:ENSBTAG00000047743 transcript:ENSBTAT00000065041 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNVRRVESISAQLEEASSTGGFLYTQNSTKRSIKERLMKLLPCSAAKTSSPAVQNSVEDE
LEMATVRHRPEALELLEAQSKFTKKELQILYRGFKNECPSGVVNEDTFKEIYSQFFPQGD
STTYAHFLFNAFDTDHNGAVSFEDFIKGLSILLRGTVQEKLNWAFNLYDINKDGYITKEE
MLDIMKAIYDMMGKCTYPVLKEDAPRQHVETFFQKMDKNKDGVVTIDEFIESCQKDENIM
RSMQLFENVI
Download sequence
Identical sequences Q2KI69
ENSBTAP00000054167 ENSBTAP00000054167 NP_001070403.1.59421 NP_001070403.1.76553 XP_004009780.1.66739 XP_004266239.1.21590 XP_005681521.1.57651 XP_005897132.1.15283 XP_006063331.1.26621 XP_010858530.1.44457 XP_019783977.1.83887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]