SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000054336 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000054336
Domain Number 1 Region: 4-274
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.17e-81
Family Eukaryotic proteases 0.0000121
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000054336   Gene: ENSBTAG00000046722   Transcript: ENSBTAT00000066317
Sequence length 280
Comment pep:known chromosome:UMD3.1:25:1006912:1008669:-1 gene:ENSBTAG00000046722 transcript:ENSBTAT00000066317 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLWLLVMTLPCLGHSVPVTLGPGSGRELVGIVGGCDVSARSYLWQVSLRFYNRTAGLWIH
FCGGSLIHPQWVLTAAHCVKPKSQKASTIRVQVGQLRLYDHDELTKVSKIVQHPDYDQIL
SAEGGADIALLRLEAPVSLSSHVQVVSLPPASLTVPERKMCWVSGWGKVTVHSPLPPPYH
LQEVEVPIVGNQVCNQHYQKLENSTKPIKDDMLCAGSKGQDSCKGDSGGALVCLWKCSWV
QVGVVSWGHKCALPDFPGVYTRVTSYMSWIRQYVPLSPGP
Download sequence
Identical sequences G3MXR7
ENSBTAP00000054336 XP_001256448.2.59421 XP_002697956.1.76553 ENSBTAP00000054336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]