SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000054342 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000054342
Domain Number 1 Region: 80-330
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.19e-79
Family Eukaryotic proteases 0.00016
Further Details:      
 
Domain Number 2 Region: 2-90
Classification Level Classification E-value
Superfamily SEA domain 0.00000000000785
Family SEA domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000054342   Gene: ENSBTAG00000020298   Transcript: ENSBTAT00000064042
Sequence length 331
Comment pep:known_by_projection chromosome:UMD3.1:6:85337482:85400112:-1 gene:ENSBTAG00000020298 transcript:ENSBTAT00000064042 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELREISENLVDETFIDSALNKHYIKNQVVKLTPEEDGMTVDVIMVFQFPSAESSAVRNR
KIRSILDEKIRNTRALSINTSSVEVNGCGKRVVPLVSNRIMSGEIAGKAAWPWQASLQHN
KIHQCGATLISNTWLVTAAHCFKNKENPHQWTVSFGTKINPPLMKRNIKRIIVHERYSSP
AREYDIAVVQFSPRVSFTDDIRRICLPEASASFQPNSTVYITGFGALFYGGESQNDLREA
RLKIISDDVCKQPHVYGSDIKFGMMCAGYLEGIYDACRGDSGGPLVGKDFKDTWYLIGIV
SWGDNCGQRNKPGVYTKVTYYRNWIASKTGL
Download sequence
Identical sequences G3MXS2
ENSBTAP00000054342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]