SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000054471 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000054471
Domain Number 1 Region: 47-118
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000143
Family Calmodulin-like 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000054471   Gene: ENSBTAG00000018940   Transcript: ENSBTAT00000063568
Sequence length 301
Comment pep:known_by_projection chromosome:UMD3.1:5:106690781:106748494:1 gene:ENSBTAG00000018940 transcript:ENSBTAT00000063568 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATIDGRMVSRPRGSGRGRQGSGACLGSLDDLPCEGTQELAATQLAMLRRAQEFFQTCDK
EGKGFIARADMQRLHKELPLSLEDLEDVFDTLDADGNGFLTPEEFTTGFSHFFFSQNNPS
QEDAGAQPAQLQEEKVYQSRGDEDLGDMDEDEEAQFQTLMDRLGAQKVLEDEADVKQLWL
QLKKDEPHLLSNFEDFLTRIFSQLLEAHEEKNELECALKKKIAAYDEEIQHLYEEMEQQI
KTEKEQFLLKDTERFRARSQELERKLLSKEQELEQLVQKQKRVNFPLHPQRTQLSTLSSP
L
Download sequence
Identical sequences G3MY43
ENSBTAP00000054471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]