SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000054559 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000054559
Domain Number 1 Region: 17-89
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000884
Family RING finger domain, C3HC4 0.0087
Further Details:      
 
Domain Number 2 Region: 252-283
Classification Level Classification E-value
Superfamily SAP domain 0.0000989
Family SAP domain 0.0068
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000054559
Domain Number - Region: 201-233
Classification Level Classification E-value
Superfamily Rad50 coiled-coil Zn hook 0.00484
Family Rad50 coiled-coil Zn hook 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000054559   Gene: ENSBTAG00000012142   Transcript: ENSBTAT00000066111
Sequence length 336
Comment pep:known chromosome:UMD3.1:22:17627621:17735891:1 gene:ENSBTAG00000012142 transcript:ENSBTAT00000066111 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSLAEPRWPPALAVMKKVDDLLRCGICFEYFNIAMMIPQCSHNYCSLCIRKFLSYKTQC
PTCCVTVTEPDLKNNRVLDELVKNLNFARNHLLQFALESPPISAASSSSKNLATKADTAV
AFRHSLKQGSKLMENFLIRESGGSASELLIKENESKLSPQKKLSSPAKTRGTPSAVKSAP
GSSEDSVLETPSTSALKQVTKVDCPVCGVKIPENHINKHLDSCLSREEKKESLRSSVHKR
KPLPKTVYNLLSDRDLKKKLKQHGLSVQGNKQQLIKRHQEFVHMYNAQCDALHPKSAAEI
VQEIENMEKTRMRFEASKLNESVMGFYKEPNRKGNR
Download sequence
Identical sequences Q58DB5
ENSBTAP00000054559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]