SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000054605 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000054605
Domain Number 1 Region: 5-99,130-236
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.85e-66
Family Calponin-homology domain, CH-domain 0.0000731
Further Details:      
 
Domain Number 2 Region: 1566-1701
Classification Level Classification E-value
Superfamily Spectrin repeat 1.26e-18
Family Spectrin repeat 0.0038
Further Details:      
 
Domain Number 3 Region: 2404-2533
Classification Level Classification E-value
Superfamily Spectrin repeat 6.63e-16
Family Spectrin repeat 0.0071
Further Details:      
 
Domain Number 4 Region: 2622-2749
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000634
Family Spectrin repeat 0.0074
Further Details:      
 
Domain Number 5 Region: 1348-1483
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000264
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 6 Region: 500-640
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000275
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 7 Region: 2776-2893
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000432
Family Spectrin repeat 0.0082
Further Details:      
 
Domain Number 8 Region: 1993-2132
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000528
Family Spectrin repeat 0.0099
Further Details:      
 
Domain Number 9 Region: 2190-2345
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000106
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 10 Region: 1654-1808
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000777
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 11 Region: 1459-1571
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000533
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 12 Region: 1029-1169
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000959
Family Spectrin repeat 0.0075
Further Details:      
 
Domain Number 13 Region: 1866-2017
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000096
Family Spectrin repeat 0.0075
Further Details:      
 
Domain Number 14 Region: 831-957
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000329
Family Spectrin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000054605   Gene: ENSBTAG00000009362   Transcript: ENSBTAT00000063846
Sequence length 2990
Comment pep:known_by_projection chromosome:UMD3.1:9:90534842:90670346:-1 gene:ENSBTAG00000009362 transcript:ENSBTAT00000063846 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RKPPMVVDDLFEDMKDGVKLLALLEVLSGQKLPCEQGRRMKRIHAVANIGTALKFLEGRK
IKLVNINSTDIADGRPSIVLGLMWTIILYFQIEELTSNLPQLQALSSSTSSVDSMVSSET
ASPPSKRKVATKIQGNAKKALLNWVQYIVTKQSGIEVKDFGRSWRSGVAFHSVIHAIRPE
LVDLEKVKGRPNRENLEEAFTIAETELGIPRLLDPEDVDVDKPDEKSIMTYVAQFLKQYP
DIHSTGSDGQENDREDRLILKEMKVWIEQFERDLTRAQMTDSSLQDKYQSFKHFRVQYEM
KRKQIEHLLQPLHRDGKLSLDQALVKQAWDRVSSRLFDWHMQLDKSLPAPLGTIGAWLYR
AEVALREEITIQQVHEETANTIQRKREQHKDLLQNTDAHKRAFHEIYRTRSVNGIPVPPD
QLEDMAERFHFVSSTSELHLMKMEFLELKYRLLSLLVLAESKLKSWIIKYGGRDSVELLL
QNYISFIENSKFFEQYEVTYQILKQTAEMYVKADGSVEEAENVMKFMNETTAQWRNLSVE
VRSVRSMLEEVIANWDRYGNTVASLQAWLEDAEKMLNQSEHAKKDFFRNLPHWIQQHTAM
NDAGNFLIETCDEMVSRDLKQQLLLLNGRWRELFMEVKQYARADELDRMKKEYNDCVTIL
SDFATEAHRKLSEPLEVSFMNVKLLIQDLEDIEQRVPVMDAQYKMITKTAHLITKEISQE
EANEMFATMSGLKEQLTKVKDCYSPLLSESQQLLVPLEELEKQMTAFYDSLGKIDEIMTV
LEHEAQSSPLFKQKHQELLACQESCKKAMTQIEKGSQSVQKFVTLSNVLKHFDQTKLQRK
IADTHVAFQNMVKKTGDWKKHVETNSRLMKKFEESRAELEKVLRVAQEGLEEKGDPEDLL
KRHTEFFSQLDQRVLNAFLKACDELTDILPEQEQRGLQEAVRKLHKQWKDLQAEAPYHLL
HLKIEVEKNRFLASVEECRAELDRETKLVPQEGSEKIIKEHRIFFSDKGPHHLCEKRLQL
IEELCLKLPVRDAVRNTPETCHVTLKELRAAIDRTYVKLVGDPDKWKDYTSRISEFSSWI
SAKETQLKGIKNETIDTANQGEVKCALEEIRSGITKKGETLSWLKSRLKILIEVSSEDEA
QKQGDELAKLSSSFKALGTLLSEVEKMLSNFGDCVQYKEIVKSSLEELITGSKEVQEEAE
KILDTENLFEAQQLLLHHQQKTKRINAKKKDVQQQITQAQKGEGGLPGRVQEELQKLEST
LDSVEHSREKQERRIQVTLRKWERFETNKETVVRYLFQTGSSHERFLSFSSLESLSSELE
QTKEFSKRTEGIAVQAENLVKEASEIPLGPKNKQLLQQQAKSIKEQVKKLEDTLEEDIKT
MEMVKNKWDHFGTNFETLSVWITEKEKELNALETSSSAMDTQINQIKVMIKEIESEISSI
TGLEEEAQSFAQFVTTGESARIKAKLTQIRRYWEELREHAQSLQGIILGHLSQQQKFEEN
LKKIQQSVSEFEDKLADPVKICSSATETYKVLQEHMDLCQALESLTSTVAALSASARKVS
NRDASIQEAATVQRSFEGLLGRAKERQTELEKLLARWQRLEKELSTFLTWLERCEAIASS
PEADISADRVKVESELQSIQVLQNEVVSQASIYSNLLQLKESLFSVASKDDVKMMKLQLD
QLDERWRDLPQIISKRINFLQSVVAEHQQFDELLLSFSVWIKLFLSELQTTSEISIMDHQ
AALTRHKDHAAEVESKKGELQSLQGHLAKLGALGRAEDLHLLQGKAEDCLQLFEEASQVV
ERRQHALSQLAEFLQSHASLSESLHQLRQTVESTHSMNKKQSDLLERDLNDAIRNVKTLE
SAAISLDGLLTKAQYHLKSGGSEQRTSCRATSDHLSVELERIQNLLGTKQSEADALAVLK
KAFRDQKEELLKSIEDIEERTDKERLKDLTRQALQQRLRVFNQLEDELNSHEHELCWLKD
KAKQIAQKDVAFAPEVDKEINRLEVTWNDTKKLIHENQGQCCGLIDLMREYQNLKSAITK
VLENASNVIATRTTVKDQEDLKWALSKHEAAKNEMCNKQKDLDNFTSKGKQLLSELKKIH
SGDFIVVKTDMESTVDKWLDISEKIEENMDRLRVSLSIWDDILTSKDEIDGWSNHSVPQL
TESISNLNDSLRAEEFLKEFESEVKKKALRLEELHSKVNDLKELTKNPETPPDLQFIEAD
LRQKLEHAKEITEEAKGTLKEFTAQSAQVEKFINDTATWLTKLEESLMNCAQTETCEGLK
KVKDIQKELQSQQSNISMTQENLNSLCRKYHSVELGSLGSAMTGLIKRHEAVSQSCSKTQ
ASLQDSLEKHFNESMQLFQEWFSGIKAAAKESSDRTGDSKVLEAKLRDLQKQNILDSVSD
GQSKLDAVTREGQTLYAHLSKQIVSSIQEQVTKANEEFQAFLKQCLKDRQALQDCALELG
SFEDQHRKLNLWIHEMEERLSTENLGESKQHIPEKKNEVHKIEMFLGELLAARESLDKLS
QRGQLLSEEGHGAGKESRLCSQLLTSYQNLLRMTKEKLRSCQVALQEHEALEEALQSMWS
WVKDMQDRLASAESTVGSKDALERRLLQVQEILLMKGEGEVKLNMAIGKGEQALRSSNKE
GQKVIQTQLQTLKDVWANIVDSSIHAQSTLESVISQWNDYLEWKNQLEQWMESVDQKVEH
PLQPQPGLKEKFSLLDHFQSVVSEAEDHAGALQRLTAKARELYQKTEDEALTDTAQEELK
TQFNDILTVSKEKMRKVEEIVKDHLMYLDAVQEFTDWLHSAKEELHRWSDMSGDSPATQK
KLSKIKELMDSREIGASRLSRVESLAPAVKRNTTASGCELLDTEMQALRADWKQWEDSVF
QTQTSLENLVSQMALSEQEFSGQVAQLEQALEQFSALLTSWTQQLALLEGKNTDKELVEC
WQKGREILDALQKAEPQTENLKSQLNELCRFSRDLSTYSGKVSGLIKEYN
Download sequence
Identical sequences G3MYH3
ENSBTAP00000054605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]